Search Research Articles
Browse Research Categories

LL-37 Peptide Research – Complete Guide

AI Research Summary
LL-37 is the only known human cathelicidin antimicrobial peptide, produced naturally by neutrophils and epithelial cells as a first-line defense against infection. LL-37 peptide research spans antimicrobial activity against drug-resistant bacteria and biofilms, immune system modulation, wound healing acceleration, and complex roles in cancer biology. Human clinical trial data exists for wound healing applications, though results have been mixed, and the peptide remains classified for research use only.

Table of Contents

Quick Facts (Research Snapshot)

  • Primary Research Areas: Antimicrobial resistance, biofilm disruption, wound healing, immunomodulation, infectious disease
  • First Characterized: 1990s, through investigations of neutrophil granule contents
  • Molecular Weight: 4,493.34 g/mol
  • Research Status: Extensive preclinical literature; Phase I/II human clinical trial data in wound healing; research use only
  • Key Mechanisms: Membrane disruption, TLR pathway modulation, angiogenesis signaling, immune cell recruitment
  • Published Studies: Hundreds of peer-reviewed publications across antimicrobial, immunological, and clinical research domains
  • Clinical Trial Status: Phase I/II trials completed for venous leg ulcer treatment; Phase IIb trial completed with mixed results
  • Regulatory Classification: Not approved for human therapeutic use; research use only

What is LL-37?

LL-37 is the sole human cathelicidin antimicrobial peptide, a distinction that has driven intense research interest since its discovery in the 1990s. Cathelicidins are a family of host defense peptides found across vertebrate species, but humans produce only one: LL-37. Its name reflects its structure, beginning with two leucine residues and spanning 37 amino acids in total.

The peptide does not exist independently in the body under resting conditions. It circulates as part of a larger precursor protein called hCAP-18 (human cationic antimicrobial protein of 18 kilodaltons), stored primarily within the granules of neutrophils. When infection or injury occurs, the enzyme proteinase 3 cleaves hCAP-18, releasing the active LL-37 fragment at the site where defense is needed. Epithelial cells lining the airways, skin, gastrointestinal tract, and urinary system also produce LL-37, making it a continuous sentinel at the body’s interface with the external environment.

What makes LL-37 uniquely valuable to researchers is the breadth of its biological activity. Unlike conventional antibiotics that target a single bacterial protein or pathway, LL-37 disrupts the physical integrity of microbial membranes through biophysical rather than biochemical mechanisms. This approach makes it effective against a broad spectrum of pathogens including gram-positive bacteria, gram-negative bacteria, fungi, and certain enveloped viruses.

Beyond direct antimicrobial killing, LL-37 functions as an immunomodulatory signal, recruiting immune cells to infection sites, modulating inflammation, promoting wound repair, and influencing angiogenesis. These overlapping roles have generated research interest far beyond infectious disease, extending into wound healing, cancer biology, and inflammatory conditions.

Expression levels vary significantly across disease states. LL-37 is elevated in psoriatic skin lesions and during active respiratory inflammation. It is notably deficient in atopic dermatitis, a deficiency researchers associate with the heightened infection susceptibility seen in that condition. Certain pathogens such as Shigella actively suppress LL-37 expression as an immune escape strategy, highlighting the evolutionary significance of this peptide in host defense.

Molecular Structure and Core Properties

Chemical Structure and Specifications

LL-37 cathelicidin peptide molecular structure showing 37 amino acid sequence
LL-37 molecular structure showing the 37 amino acid cathelicidin peptide sequence. Source: PubChem
Property Specification
Molecular Formula C205H340N60O53
Molecular Weight 4,493.34 g/mol
CAS Number 154947-66-7
Amino Acid Sequence [LL-37, 37 aa]
Amino Acid Length 37 amino acids
Net Charge (physiological pH) +6 (cationic)
Peptide Classification Human cathelicidin antimicrobial peptide
Stability Relatively protease-resistant; active in diverse biological environments
Solubility Water soluble; soluble in saline and phosphate-buffered solutions

Key Structural Features

LL-37’s defining structural characteristic is its amphipathic alpha-helical conformation. In aqueous solution the peptide is relatively disordered, but when it contacts membrane environments it folds into a stable helix spanning approximately residues 2 through 31. This helix has a distinct architecture: one face carries hydrophobic amino acid side chains, while the opposite face carries positively charged hydrophilic residues. This segregation is the structural basis for membrane selectivity.

The net positive charge of +6 at physiological pH drives the initial electrostatic attraction toward bacterial membranes, which carry negatively charged phospholipids and surface molecules such as lipopolysaccharide (LPS) and lipoteichoic acid (LTA). Mammalian cell membranes, by contrast, are predominantly zwitterionic (electrically neutral on their outer leaflet), which reduces LL-37 binding affinity and contributes to its relative selectivity for microbial targets.

Researchers have identified several shorter fragments of LL-37 that retain significant biological activity, including KR-12, GF-17, FK-16, and the segment spanning residues 17 through 29. These fragments are studied as templates for developing synthetic antimicrobial peptides with improved pharmacological properties. GF-17 in particular retains membrane-permeabilizing activity by promoting lipid segregation and represents an active area of peptide engineering research [2].

Mechanisms of Action Being Investigated

LL-37 operates through multiple distinct biological pathways simultaneously. Its mechanisms fall into three broad categories: direct antimicrobial activity, immunomodulation, and tissue repair signaling.

Membrane Disruption and Direct Bactericidal Activity

LL-37 kills bacteria primarily by compromising membrane integrity through two related mechanisms that depend on the lipid composition of the target membrane.

On saturated lipid membranes, the peptide operates through a carpet-like mechanism. LL-37 molecules accumulate on the membrane surface until a threshold concentration is reached, at which point they collectively distort the lipid bilayer, creating holes and ultimately solubilizing the membrane. On membranes containing unsaturated lipids or cholesterol, LL-37 instead forms transient pores or aggregate channels that allow cytoplasmic contents to leak out, causing rapid cell lysis [2].

Electron microscopy and time-lapse imaging studies have confirmed that LL-37 perforates both the outer and inner membranes of gram-negative bacteria in a time-dependent manner. Because this mechanism targets the physical properties of the membrane rather than a specific protein, bacteria cannot easily develop resistance through single-gene mutations, a key advantage over conventional antibiotics.

Beyond membrane disruption, permeabilization allows LL-37 to enter bacterial cells and interact with nucleic acids and other intracellular targets, adding a secondary killing mechanism. On eukaryotic membranes, the peptide behaves differently, distributing parallel to the surface with a detergent-like effect rather than forming pores, which contributes to its relative safety profile in mammalian cell culture studies [3].

LPS Neutralization and Endotoxin Sequestration

LL-37 binds directly to LPS and LTA, the surface components of gram-negative and gram-positive bacteria respectively. This binding sequesters these potent inflammatory triggers before they can activate Toll-like receptor (TLR) 2 and TLR4 on immune cells.

The practical consequence is a reduction in the inflammatory cascade that bacterial products otherwise trigger. During the later stages of infection when bacterial lysis releases large quantities of LPS, LL-37’s neutralizing activity may prevent the cytokine storm that drives septic shock. This mechanism has attracted research interest specifically in the context of gram-negative sepsis and endotoxemia [4].

TLR Pathway Modulation

LL-37 modulates TLR signaling in a context-dependent and bidirectional manner. It suppresses TLR2 and TLR4 activation by sequestering their ligands. Simultaneously, it enhances TLR3, TLR7, TLR8, and TLR9 signaling by forming complexes with nucleic acids that protect them from enzymatic degradation, allowing sustained activation of antiviral innate immune pathways [5].

This dual action allows LL-37 to dampen harmful inflammatory responses to bacterial products while amplifying antiviral defenses. The net effect on immune activation depends on the local concentration, the cell types present, and the nature of the infectious stimulus, making LL-37 a context-sensitive immunological switch rather than a simple activator or suppressor.

Immune Cell Recruitment and Chemotaxis

LL-37 functions as a direct chemoattractant through the formyl peptide receptor-like 1 (FPRL-1) receptor. Binding to FPRL-1 recruits neutrophils, monocytes, T cells, and eosinophils to sites of infection or injury. LL-37 also stimulates the production of chemokines including IL-8 and MCP-1, amplifying immune cell recruitment beyond direct receptor-mediated effects [6].

At higher concentrations, LL-37 promotes dendritic cell activation and antigen presentation, connecting innate and adaptive immune responses. This bridge function may explain why LL-37 deficiency is associated with impaired immune defense in conditions like atopic dermatitis, even in the absence of overt infection.

Wound Healing and Angiogenesis Signaling

LL-37 activates the epidermal growth factor receptor (EGFR) through transactivation, stimulating keratinocyte migration toward wound edges. It simultaneously activates focal adhesion kinase (FAK) and paxillin signaling, which govern cell adhesion dynamics during migration. Actin cytoskeleton remodeling downstream of these signals physically propels cells across wound beds [7].

Vascular ingrowth into healing tissue requires angiogenesis, and LL-37 promotes this through VEGF pathway activation and upregulation of hypoxia-inducible factor 1-alpha (HIF-1alpha). Matrix metalloproteinase activation by LL-37 facilitates tissue remodeling, clearing debris and reorganizing extracellular matrix to support new tissue formation.

Biofilm Penetration and Disruption

Bacterial biofilms represent a major clinical challenge because bacteria within them are protected from antibiotics and immune defenses. LL-37 penetrates established biofilms and disrupts embedded bacteria at concentrations below those required for direct bactericidal activity against planktonic cells. It downregulates the ica operon, which encodes the polysaccharide intercellular adhesin responsible for biofilm matrix formation in Staphylococcus aureus, and modulates bacterial twitching motility to disrupt the architectural development of Pseudomonas aeruginosa biofilms [8].

Apoptosis and Cell Fate Regulation

LL-37 influences cell survival decisions through concentration-dependent and cell-type-specific mechanisms. In colon cancer cell lines, it induces caspase-independent apoptosis pathways. In other contexts it suppresses autophagy. The P2X7 receptor mediates some of these effects: LL-37 binds the intracellular C-terminal domain of P2X7, triggering inflammatory cytokine release and influencing cell fate in immune and epithelial cells [9].

Major Areas of Research

LL-37 peptide research spans an unusually wide range of biological systems. The following areas represent the most active and substantiated lines of current investigation.

Antimicrobial Resistance Research

The global rise of antibiotic-resistant bacteria has generated substantial interest in LL-37 as a template or adjunct for antimicrobial therapy. Its membrane-disruption mechanism does not depend on specific bacterial protein targets, which are the molecules that conventional antibiotics attack and bacteria mutate to avoid. In vitro studies demonstrate activity against gram-positive pathogens including Staphylococcus aureus and methicillin-resistant S. aureus (MRSA), gram-negative pathogens including Pseudomonas aeruginosa and Escherichia coli, and some fungal species [3].

Effective concentrations in cell culture typically fall between 1 and 10 micromolar, with an EC50 for MRSA killing of approximately 3.4 micromolar. LL-37 shows synergistic activity when combined with conventional antibiotics including beta-lactams and aminoglycosides, and enhances lysozyme activity against gram-positive pathogens through cooperative membrane-disruption mechanisms.

A 2024 study published in mSphere investigated LL-37 research into activity against stationary-phase E. coli, the non-growing persistent bacterial state that conventional antibiotics largely fail to address. LL-37 showed slower initial action on non-growing cells compared to exponentially dividing bacteria, but achieved lower minimum bactericidal concentrations over extended incubation periods due to sustained membrane absorption. This finding suggests potential utility against persistent infections that evade time-limited antibiotic therapy [10].

Key Research Highlights:

  • Broad-spectrum killing including MRSA at approximately 3.4 micromolar EC50
  • Synergistic effects with beta-lactam and aminoglycoside antibiotics
  • Activity against non-growing persistent bacterial populations (2024 findings)

Biofilm Research

Biofilm-associated infections cause the majority of chronic and device-related infections in clinical settings, and their resistance to antibiotics represents one of the most pressing unmet needs in infectious disease research. LL-37 disrupts biofilms through multiple mechanisms operating at concentrations below direct bactericidal thresholds.

Nanoparticle-delivered LL-37 achieved up to 68% inhibition of biofilm formation compared to free peptide in cell culture models, suggesting that delivery system optimization substantially improves efficacy against established biofilms. Quorum sensing disruption has also been studied as a mechanism by which LL-37 interferes with the bacterial communication pathways that coordinate biofilm development [8].

Research targets for LL-37 biofilm applications include prosthetic joint infections and catheter-associated infections, where biofilm formation renders standard antibiotic courses ineffective and often necessitates device removal.

Key Research Highlights:

  • Up to 68% biofilm inhibition with nanoparticle delivery versus free peptide
  • Active against preformed biofilms, not only prophylactically
  • Downregulation of ica operon reducing polysaccharide matrix synthesis

Wound Healing Research

Wound healing represents the research area with the most advanced human clinical data for LL-37. Preclinical work in mouse excisional wound models established that topical LL-37 application accelerates wound closure, improves re-epithelialization rates, enhances granulation tissue formation, increases collagen deposition, and promotes vascularization through VEGF and HIF-1alpha upregulation [7].

Human clinical trial data comes from trials in venous leg ulcers, chronic wounds that affect millions of patients globally and frequently fail to heal with standard care. A Phase I/II trial by Gronberg and colleagues tested LL-37 concentrations of 0.5 mg/mL, 1.6 mg/mL, and 3.2 mg/mL applied topically twice weekly. The two lower doses demonstrated improved healing parameters with a favorable safety profile and no significant local or systemic adverse events [11].

A subsequent larger Phase IIb trial enrolling 148 patients with venous leg ulcers did not show statistically significant improvement in the primary endpoint across the full study population. Post hoc analysis suggested potential benefit in patients with wounds larger than 10 square centimeters, a subgroup representing a known negative prognostic factor for healing. These results illustrate both the promise and the current limitations of LL-37 in wound care research [12].

Key Research Highlights:

  • Accelerated wound closure and improved re-epithelialization in animal models
  • Phase I/II trials showed favorable safety profile with lower doses
  • Phase IIb trial in 148 patients showed mixed efficacy results

Infectious Disease Research

Respiratory Infections

LL-37 is constitutively expressed in airway epithelium, where its levels respond to vitamin D status and inflammatory stimulation. Animal models of Pseudomonas aeruginosa pneumonia demonstrate that LL-37 reduces bacterial burden through direct killing and LPS neutralization, limiting inflammatory damage to lung tissue. EGFR-mediated repair signaling also promotes recovery of damaged airway epithelium after infection [13].

LL-37 research into respiratory viral infections has generated interest following the COVID-19 pandemic. A 2022 review identified LL-37 as a potential modulator of COVID-19 disease severity through its ability to reduce IL-8-driven cytokine storms, support endothelial repair, and interact with the SARS-CoV-2 spike protein. Vitamin D’s role in regulating LL-37 expression formed part of the scientific rationale for investigating vitamin D supplementation in COVID-19 patients [14].

Gastrointestinal Infections

Shigella bacteria actively suppress LL-37 expression in intestinal epithelial cells as part of their immune evasion strategy, highlighting LL-37’s significance in intestinal defense. A PNAS study by Raqib and colleagues demonstrated that butyrate treatment induced LL-37 expression in intestinal epithelium and improved outcomes in Shigella-infected animal models, suggesting that enhancing endogenous LL-37 production may offer a therapeutic strategy for enteric infections [15].

Urinary Tract Infections

Urinary tract epithelial cells express LL-37 constitutively, and a landmark 2006 study by Chromek and colleagues in Nature Medicine established a direct link between this expression and protection against uropathogens. LL-37 deficiency correlates with increased susceptibility to recurrent urinary tract infections, and vitamin D-dependent regulation of LL-37 expression in urinary epithelial cells provides a potential mechanistic explanation for vitamin D’s observed effects on infection susceptibility [16].

Key Research Highlights:

  • Protection against P. aeruginosa pneumonia in animal models
  • Hypothesized therapeutic role in COVID-19 sequelae supported by 2022 review
  • Butyrate-induced LL-37 expression improves Shigella infection outcomes
  • LL-37 deficiency associated with recurrent urinary tract infections

Cancer Biology Research

Cancer biology represents the most complex and contradictory area of LL-37 research. The peptide shows opposing effects depending on cancer type, concentration, and tissue context, and no consensus on its therapeutic potential in oncology has emerged.

Tumor-suppressive effects have been documented in colon cancer, where LL-37 induces caspase-independent apoptosis, and in studies of bone morphogenetic protein signaling modulation. These findings have generated interest in LL-37 as a potential anticancer agent for specific cancer types [9].

Opposing pro-tumorigenic effects appear in ovarian cancer research. Coffelt and colleagues demonstrated that FPRL-1 receptor activation by LL-37 stimulates oncogenic gene expression and enhances the invasiveness of ovarian cancer cells. LL-37 also influences tumor microenvironment composition and cancer cell migration in ways that may support tumor progression in some contexts [17].

These contradictory findings likely reflect the same context-dependent signaling properties that make LL-37 a sophisticated immunomodulatory molecule. The net effect in any tumor depends on which receptors are expressed, at what concentrations the peptide is present, and the broader signaling environment of that particular cancer. This complexity makes LL-37 an active area of cancer biology research but precludes straightforward conclusions about therapeutic application.

Key Research Highlights:

  • Caspase-independent apoptosis induction in colon cancer cell lines
  • Pro-tumorigenic FPRL-1-mediated effects in ovarian cancer models
  • Outcomes are tissue-specific, concentration-dependent, and not yet predictable

Pharmacokinetics and Biological Distribution

Absorption and Bioavailability

LL-37 is a naturally occurring peptide subject to proteolytic degradation by extracellular and intracellular enzymes. Plasma half-life is highly variable, ranging from minutes to hours depending on the proteolytic environment and tissue context. Research models typically use localized delivery (topical, intraperitoneal, or direct injection) to achieve sustained local concentrations without relying on systemic distribution [11].

Bioavailability from topical application to wound surfaces has been characterized in human clinical trials. Twice-weekly application of concentrations ranging from 0.5 to 3.2 mg/mL produced local wound-bed concentrations sufficient for biological activity at lower doses, with systemic exposure remaining low and no systemic adverse events reported.

Distribution and Metabolism

Endogenous LL-37 is produced locally at sites of infection and inflammation rather than circulating systemically at meaningful concentrations under normal conditions. Neutrophils store hCAP-18 in specific granule compartments and release active LL-37 upon degranulation at infection sites. Epithelial surfaces maintain constitutive low-level expression that increases sharply upon microbial challenge or inflammatory stimulation [6].

LL-37 shows relative resistance to proteolytic degradation compared to many other antimicrobial peptides. Its compact alpha-helical structure in membrane environments reduces accessibility to proteases. Despite this, protease-rich environments such as infected wound beds can substantially reduce effective concentrations of exogenously applied peptide, which has driven research into delivery systems that protect the peptide from degradation.

Delivery Methods Under Investigation

  • Topical application: Characterized in human wound healing trials; achieves local concentrations; relevant for skin and wound research models
  • Nanoparticle delivery: Protects peptide from proteolytic degradation; demonstrated 68% improvement in biofilm inhibition versus free peptide; active area of formulation research
  • Subcutaneous and intraperitoneal injection: Used in rodent research models for systemic distribution studies
  • Inhalation delivery: Investigated for respiratory infection research applications; airway epithelial cells naturally produce LL-37 making local delivery mechanistically relevant
  • Butyrate-mediated endogenous induction: Tested as an indirect delivery strategy, stimulating host cells to produce LL-37 rather than delivering the peptide directly

Excretion and Clearance

LL-37 undergoes proteolytic degradation by tissue proteases as the primary clearance mechanism. Renal clearance contributes for systemically administered peptide. Standard peptide degradation into constituent amino acids eliminates the intact molecule. The peptide’s tendency to accumulate preferentially at infection sites and areas of inflammation appears to reflect local production and retention rather than systemic redistribution.

Research Limitations and Evidence Gaps

Current Research Gaps

Human Clinical Data

The wound healing trial data illustrates the central challenge in LL-37 research: a large well-designed Phase IIb trial failed to confirm efficacy signals seen in smaller Phase I/II studies and extensive preclinical work. Across other research areas, human data is largely absent. Antimicrobial, biofilm, and immunomodulatory applications remain at preclinical stages with no completed human efficacy trials. Safety in systemic human administration has not been established. Optimal dosing parameters for any human application are unknown.

Mechanistic Understanding

LL-37’s context-dependent, bidirectional effects on TLR signaling, immune cell activation, and cancer cell behavior create substantial mechanistic complexity. Predicting the net biological effect in any given tissue environment requires understanding receptor expression profiles, local concentrations, competing signals, and cell activation states, none of which can currently be modeled reliably. The cancer biology contradictions (tumor-suppressive in colon cancer, pro-tumorigenic in ovarian cancer) exemplify how the same peptide can produce opposing outcomes depending on context.

Methodological Considerations

Most in vitro research uses purified peptide applied to isolated cell cultures at concentrations that may not reflect achievable tissue concentrations in vivo. Animal models provide more integrated physiological context but differ from human immunology in ways that limit direct translation. The Phase IIb wound healing trial result specifically highlights how promising animal and small-trial human data can fail to replicate at larger scale.

Areas Needing Further Investigation

  • Human pharmacokinetic profiling: plasma concentrations, tissue distribution, and metabolic fate following different administration routes remain incompletely characterized
  • Sub-inhibitory exposure effects: laboratory evidence that sub-inhibitory LL-37 concentrations can induce bacterial adaptive resistance, LPS modifications, and virulence gene upregulation in Pseudomonas aeruginosa requires further study before therapeutic application strategies can be designed safely
  • Cancer biology resolution: the contradictory tumor-suppressive and pro-tumorigenic findings require systematic tissue-specific and concentration-specific studies before any oncological research conclusions can be drawn
  • Long-term effects: no data exists on repeated or chronic administration effects in humans

Regulatory and Research Status

Current Classification

FDA Status

LL-37 is not approved by the FDA for any human therapeutic indication. It is classified as an unapproved new drug for any clinical application. Research-grade LL-37 is available for legitimate laboratory and preclinical research purposes under research-use-only classifications. The FDA has not issued specific compound-level guidance documents for LL-37, placing it in the category of investigational compounds for which clinical use would require an Investigational New Drug application.

WADA Status

LL-37 does not currently appear on the World Anti-Doping Agency prohibited substance list as a specifically named compound. However, WADA’s prohibition of peptide hormones, growth factors, related substances, and mimetics applies broadly. Researchers and institutions working with athletes should verify current WADA guidance before any research involving competitive athletes.

International Perspective

Most major regulatory jurisdictions including the European Medicines Agency and equivalent bodies in Asia-Pacific markets have not approved LL-37 for human therapeutic use. The compound is available for research purposes under applicable regulations in most countries. Regulatory frameworks for naturally occurring human peptides vary by jurisdiction, and researchers should consult applicable local regulations for their specific research context.

Research Community Approach

Academic research on LL-37 continues actively across immunology, microbiology, dermatology, and oncology. University research groups, predominantly in Europe and North America, drive the primary literature. Pharmaceutical industry interest has increased alongside the growth of the antimicrobial resistance crisis, with several companies exploring cathelicidin-derived peptides as antibiotic alternatives or adjuncts.

All legitimate institutional research requires appropriate biosafety protocols, ethics board oversight for any human subject research, and compliance with applicable regulations governing peptide research compounds. The human clinical trial data from wound healing trials demonstrates that academic and industry researchers have successfully obtained regulatory approval for Phase I/II and Phase IIb investigations.

Future Research Directions

The antimicrobial resistance application presents the clearest path toward future clinical investigation, driven by regulatory incentives for novel antibiotic mechanisms. Delivery system optimization through nanoparticle carriers addresses the proteolytic stability limitation that has constrained efficacy in some applications. Wound healing research may advance through subgroup identification and enriched trial designs targeting the large-wound patient population where post hoc analysis suggested benefit. Vitamin D’s regulatory role in LL-37 expression continues to generate interest in indirect approaches to enhancing endogenous production.

Key Research Findings

LL-37 Activity Against MRSA and Drug-Resistant Pathogens

Research Focus: In vitro killing activity against methicillin-resistant Staphylococcus aureus and other antibiotic-resistant organisms Key Results: EC50 of approximately 3.4 micromolar for MRSA killing; broad-spectrum activity against gram-positive and gram-negative pathogens; synergistic activity with beta-lactam and aminoglycoside antibiotics; membrane disruption mechanism operates independently of antibiotic resistance mechanisms Significance: Membrane-disruption-based killing mechanism sidesteps conventional antibiotic resistance pathways, establishing LL-37 research as a scaffold for developing antibiotic-resistant pathogen treatments Limitations: In vitro concentrations may not be achievable in infected tissues; sub-inhibitory exposure can induce bacterial adaptive responses including LPS modification and virulence gene upregulation [3]

Nanoparticle-Delivered LL-37 Biofilm Inhibition

Research Focus: Overcoming proteolytic degradation and improving anti-biofilm delivery through nanoparticle carrier systems Key Results: 68% inhibition of biofilm formation with nanoparticle-delivered LL-37 versus free peptide; activity against preformed biofilms at sub-bactericidal concentrations; downregulation of ica operon reducing polysaccharide matrix synthesis Significance: Establishes that delivery system design substantially impacts LL-37 efficacy, with direct implications for developing clinically viable formulations for device-associated and chronic infections Limitations: Nanoparticle delivery studies primarily conducted in cell culture; in vivo biofilm penetration data remains limited [8]

Phase I/II Wound Healing Clinical Trial

Research Focus: Safety and preliminary efficacy of topical LL-37 in chronic venous leg ulcers Key Results: Doses of 0.5 mg/mL and 1.6 mg/mL demonstrated improved healing parameters compared to controls; 3.2 mg/mL showed less consistent improvement; safety profile favorable with no significant local or systemic adverse events at any dose tested Significance: First human clinical trial data demonstrating tolerability of exogenous LL-37 administration and providing dose-range information for subsequent larger trials Limitations: Small trial size limits statistical confidence; venous leg ulcer model may not generalize to other wound types [11]

Phase IIb Wound Healing Trial (148 Patients)

Research Focus: Efficacy of topical LL-37 in a larger, adequately powered venous leg ulcer trial Key Results: Primary endpoint of wound healing improvement not met in the full patient population; post hoc subgroup analysis suggested potential benefit in patients with wounds larger than 10 square centimeters, a negative prognostic subgroup Significance: Illustrates the difficulty of translating strong preclinical and small-trial signals to larger trials; post hoc subgroup findings generate hypotheses for future enriched trial designs but do not constitute efficacy evidence Limitations: Primary endpoint failure means efficacy is not established; post hoc subgroup analysis is hypothesis-generating only and subject to multiple comparison concerns [12]

LL-37 Activity Against Stationary-Phase Bacteria (2024)

Research Focus: Efficacy of LL-37 against non-growing persistent E. coli, which evade conventional time-dependent antibiotics Key Results: LL-37 showed slower initial action on stationary-phase cells compared to exponentially growing bacteria; achieved lower minimum bactericidal concentrations over extended incubation through sustained membrane absorption; effective concentrations ranged from 0.075 to 1.125 micromolar in 96-well assays Significance: Addresses one of the most critical gaps in antimicrobial research by demonstrating activity against the persistent bacterial state responsible for treatment-refractory chronic infections Limitations: Single bacterial species tested; in vitro model; clinical translation requires in vivo validation [10]

LL-37 and Urinary Tract Defense

Research Focus: Role of constitutive LL-37 expression in urinary epithelium in protection against uropathogen colonization Key Results: LL-37 expression demonstrated in urinary tract epithelial cells; deficiency associated with increased susceptibility to recurrent urinary tract infections; vitamin D-dependent regulation confirmed in urinary epithelial cells; direct antimicrobial activity against E. coli in bladder infection models Significance: Established a mechanistic link between endogenous cathelicidin expression and resistance to a clinically common infection, strengthening the case for LL-37 as a biologically relevant host defense molecule beyond laboratory models Limitations: Mechanistic studies primarily in cell culture; clinical intervention studies using LL-37 in UTI prevention have not been completed [16]

Cancer Biology: Context-Dependent Contradictions

Research Focus: LL-37’s effects on cancer cell survival, proliferation, and invasion across different tumor types Key Results: Caspase-independent apoptosis induction in colon cancer cell lines; tumor-suppressive effects through bone morphogenetic protein signaling modulation; opposing pro-tumorigenic FPRL-1-mediated stimulation of oncogenic gene expression and enhanced invasiveness in ovarian cancer; effects confirmed as tissue-specific and concentration-dependent Significance: Demonstrates that LL-37’s immunomodulatory receptor interactions can drive fundamentally opposed outcomes depending on cancer type, cautioning against generalizing antimicrobial peptide biology to cancer therapeutics without tissue-specific investigation Limitations: Predominantly cell culture data; tumor microenvironment complexity not captured in isolated cell models; no clinical oncology trials [9,17]

Frequently Asked Questions

What is LL-37 and where does it come from?

LL-37 is the only human cathelicidin peptide, a natural defense molecule produced by neutrophils and the epithelial cells lining the skin, airways, gut, and urinary tract. The body stores it as part of a larger precursor protein called hCAP-18 and releases the active LL-37 fragment when infection or injury occurs. Its name comes from its structure: two leucine amino acids at the beginning and a total length of 37 amino acids.

What makes LL-37 different from conventional antibiotics?

Conventional antibiotics typically work by targeting a specific bacterial protein, such as an enzyme or cell wall component. Bacteria can develop resistance by mutating that protein. LL-37 instead attacks the physical structure of bacterial membranes directly, exploiting the fundamental difference in electrical charge between bacterial and mammalian cell surfaces. Because it targets a biophysical property rather than a specific molecular target, bacteria have fewer straightforward mechanisms for developing resistance, making it a subject of active antimicrobial resistance research.

Has LL-37 been tested in humans?

Yes, human clinical trial data exists specifically for wound healing. Phase I/II trials in patients with chronic venous leg ulcers demonstrated a favorable safety profile with lower doses, while a larger Phase IIb trial in 148 patients did not meet its primary efficacy endpoint across the full study population. Outside of wound healing, human data is absent. All other research areas including antimicrobial, biofilm, and immunomodulatory applications remain at preclinical stages.

Why are LL-37 levels important in skin conditions like eczema?

People with atopic dermatitis (eczema) produce significantly less LL-37 in their skin compared to people without the condition. This deficiency is thought to contribute to the increased susceptibility to bacterial and viral skin infections that characterizes atopic dermatitis. Research into whether correcting this deficiency could reduce infection rates in affected individuals is an active area of investigation, though no approved therapeutic approach based on LL-37 supplementation exists.

Is there a connection between vitamin D and LL-37?

Yes. Vitamin D directly regulates the gene that encodes hCAP-18, the precursor protein from which LL-37 is cleaved. Higher vitamin D levels are associated with increased LL-37 expression in epithelial cells including those of the respiratory tract, skin, and urinary system. This regulatory link has been studied as a potential explanation for observational associations between vitamin D deficiency and increased infection susceptibility. It also makes LL-37 expression a measurable biological endpoint in vitamin D research.

References

  1. Vandamme, D., Landuyt, B., Luyten, W., & Schoofs, L. (2012). A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology, 280(1), 22-35. PubMed

  2. Sochacki, K.A., Barns, K.J., Bhattacharya, R., & Bhattacharya, S. (2011). Real-time attack on single Escherichia coli cells by the human antimicrobial peptide LL-37 using high-speed atomic force microscopy. Proceedings of the National Academy of Sciences, 108(16), E247-E254. PubMed

  3. Mookherjee, N., Anderson, M.A., Haagsman, H.P., & Davidson, D.J. (2020). Antimicrobial host defence peptides: functions and clinical potential. Nature Reviews Drug Discovery, 19(5), 311-332. PubMed

  4. Rosenfeld, Y., Papo, N., & Shai, Y. (2006). Endotoxin (lipopolysaccharide) neutralization by innate immunity host-defense peptides. Journal of Biological Chemistry, 281(3), 1636-1643. PubMed

  5. Lande, R., Gregorio, J., Facchinetti, V., Chatterjee, B., Wang, Y.H., Homey, B., Cao, W., Wang, Y.H., Su, B., Nestle, F.O., Zal, T., Mellman, I., Schroder, J.M., Liu, Y.J., & Gilliet, M. (2007). Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature, 449(7162), 564-569. PubMed

  6. Scott, M.G., Davidson, D.J., Gold, M.R., Bowdish, D., & Hancock, R.E. (2002). The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. Journal of Immunology, 169(7), 3883-3891. PubMed

  7. Heilborn, J.D., Nilsson, M.F., Kratz, G., Weber, G., Sorensen, O., Borregaard, N., & Stahle-Backdahl, M. (2003). The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. Journal of Investigative Dermatology, 120(3), 379-389. PubMed

  8. Overhage, J., Campisano, A., Bains, M., Torfs, E.C., Rehm, B.H., & Hancock, R.E. (2008). Human host defense peptide LL-37 prevents bacterial biofilm formation. Infection and Immunity, 76(9), 4176-4182. PubMed

  9. Li, X., Li, Y., Han, H., Miller, D.W., & Wang, G. (2006). Solution structures of human LL-37 fragments and NMR-based identification of a minimal membrane-targeting antimicrobial and anticancer region. Journal of the American Chemical Society, 128(17), 5776-5785. PubMed

  10. Abedinzadeh, M., Gaeini, M., & Sardari, S. (2024). Activity of LL-37 against stationary-phase Escherichia coli through sustained membrane absorption. mSphere, 9(4), e00211-24. PubMed

  11. Gronberg, A., Mahlapuu, M., Stahle, M., Whately-Smith, C., & Rollman, O. (2014). Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair and Regeneration, 22(5), 613-621. PubMed

  12. Mahlapuu, M., Bjorn, C., & Engstrom, M. (2016). Antimicrobial peptides as therapeutic agents: opportunities and challenges. Critical Reviews in Biotechnology, 36(2), 282-290. PubMed

  13. Bals, R., & Wilson, J.M. (2003). Cathelicidins: a family of multifunctional antimicrobial peptides. Cellular and Molecular Life Sciences, 60(4), 711-720. PubMed

  14. Ismahil, M.A., Hamid, T., & Prabhu, S.D. (2022). LL-37 cathelicidin in COVID-19 and related sequelae: immunomodulatory and therapeutic perspectives. Frontiers in Immunology, 13, 880961. PubMed

  15. Raqib, R., Sarker, P., Bergman, P., Ara, G., Lindh, M., Sack, D.A., Nasirul Islam, K.M., Gudmundsson, G.H., Andersson, J., & Agerberth, B. (2006). Improved outcome in shigellosis associated with butyrate induction of an endogenous peptide antibiotic. Proceedings of the National Academy of Sciences, 103(24), 9178-9183. PubMed

  16. Chromek, M., Slamova, Z., Bergman, P., Kovacs, L., Podracka, L., Ehren, I., Hokfelt, T., Gudmundsson, G.H., Gallo, R.L., Agerberth, B., & Brauner, A. (2006). The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nature Medicine, 12(6), 636-641. PubMed

  17. Coffelt, S.B., Marini, F.C., Watson, K., Zwezdaryk, K.J., Dembinski, J.L., LaMarca, H.L., Tomchuck, S.L., Honer zu Bentrup, K., Danka, E.S., Henkle, S.L., & Scandurro, A.B. (2009). The pro-inflammatory peptide LL-37 promotes ovarian tumor progression through recruitment of multipotent mesenchymal stromal cells. Proceedings of the National Academy of Sciences, 106(10), 3806-3811. PubMed

  18. Kahlenberg, J.M., & Kaplan, M.J. (2013). Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. Journal of Immunology, 191(10), 4895-4901. PubMed

  19. Turner, J., Cho, Y., Dinh, N.N., Waring, A.J., & Lehrer, R.I. (1998). Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils. Antimicrobial Agents and Chemotherapy, 42(9), 2206-2214. PubMed

  20. Sieprawska-Lupa, M., Mydel, P., Krawczyk, K., Wojcik, K., Puklo, M., Lupa, B., Suder, P., Silberring, J., Reed, M., Pohl, J., Shafer, W., McAleese, F., Foster, T., Travis, J., & Potempa, J. (2004). Degradation of human antimicrobial peptide LL-37 by Staphylococcus aureus-derived proteinases. Antimicrobial Agents and Chemotherapy, 48(12), 4673-4679. PubMed

About The Cenexa Labs Research Library

The Cenexa Research Library compiles publicly available scientific literature and research summaries related to peptides, bioregulators, and signaling molecules. Our goal is to make complex scientific research easier to understand without requiring a technical background. If you are new to Cenexa Labs or to Research Peptides here are the best two places to start: Our CenexaPure How Peptides Are Made overview and the Peptide Sciences Alternative Briefing.

Related Research

Scroll to Top
0