Availability: Out of Stock

Follistatin-344

$149.99

Follistatin-344 is a TGF-β modulator studied for muscle growth regulation through myostatin inhibition and broader metabolic research applications.

PointsEarn $7 Cenexa Bucks when you buy this product!

Availability: Out of Stock

A portion of every order supports organizations focused on children’s cancer research & care. Help us make a difference.

Buy More & Save!

Add selected quantity to cart above & discount is automatically applied.

Quantity Discount % Price Per Item
3-6 4 $143.99
7-9 7 $139.49
10-50 9 $136.49

Follistatin-344

The Multi-Pathway TGF-β Modulator

Also known as: FS-344, Activin-Binding Protein

Why Researchers Choose Follistatin-344

Unlike targeted myostatin inhibitors that work through a single pathway, Follistatin-344 binds multiple members of the TGF-β superfamily—including myostatin, activin, and several BMPs—with varying affinities. This makes it uniquely valuable for comparative studies examining how different TGF-β pathways interact, and for research requiring broader pathway modulation beyond simple muscle growth inhibition.

What It Is

Follistatin-344 peptide is a synthetic version of the 344-amino acid isoform of naturally occurring follistatin, an autocrine glycoprotein produced throughout the body, particularly in the liver and anterior pituitary. It’s the full-length precursor that generates the circulating FS-315 isoform in vivo.

Researchers became interested when early studies revealed its ability to dramatically increase muscle mass through myostatin antagonism—but further investigation showed its effects extended far beyond muscle tissue, involving metabolic regulation, fibrosis modulation, and reproductive signaling.

How It Works (What Makes It Interesting)

Research suggests Follistatin-344 peptide influences multiple biological pathways through several mechanisms:

  • High-affinity TGF-β binding – Encircles and neutralizes activin (Kd ~45 pM) and myostatin by physically blocking their receptor binding sites
  • ActRIIB receptor antagonism – Prevents myostatin and activin from engaging activin type II receptors on muscle and other cell types
  • SMAD pathway suppression – Blocks the SMAD 2/3/4 complex from entering the nucleus, preventing expression of growth-suppressive genes like those that limit muscle differentiation
  • Satellite cell activation – Promotes proliferation of muscle stem cells, enabling both fiber hypertrophy (size increase) and hyperplasia (fiber number increase)
  • Variable BMP binding – Interacts with bone morphogenetic proteins (BMPs 2, 4, 6, 7, 11, 15) at lower affinities, influencing bone formation, tissue repair, and oncogenic pathways

Common Research Applications

Muscle Wasting Disorders: Duchenne muscular dystrophy, Becker muscular dystrophy, spinal muscular atrophy (SMA), sporadic inclusion body myositis, cachexia models, sarcopenia studies

Metabolic Research: Type 2 diabetes models, insulin resistance studies, pancreatic beta-cell proliferation, glucose homeostasis, obesity-induced metabolic dysfunction, nonalcoholic fatty liver disease (NAFLD)

Fibrosis Studies: Liver fibrosis, muscle fibrosis, cardiac remodeling, extracellular matrix deposition, tissue scarring mechanisms, TGF-β-mediated fibrotic processes

Oncology Research: Breast cancer metastasis models, esophageal cancer (Barrett’s esophagus), tumor suppression vs. promotion studies, activin-mediated cancer invasion, hepatocellular carcinoma

Neuromuscular Research: Motor neuron preservation, neuromuscular junction stability, amyotrophic lateral sclerosis (ALS) models, nerve-muscle interaction studies

Reproductive Biology: Polycystic ovary syndrome (PCOS), fertility studies, follicle-stimulating hormone (FSH) regulation, gonadal function, reproductive aging models

What You’re Getting

Every batch of our Follistatin-344 peptide meets rigorous research standards:

  • Exceeds 99% Purity – Verified by HPLC analysis
  • Certificate of Analysis (COA) – Included with every order, showing purity and identity confirmation
  • Endotoxin-Free – Tested to ensure <1 EU/mg for cell culture applications
  • Manufactured in USA – GMP-certified facilities with full traceability
  • Sterile & Lyophilized – Stable for long-term storage, easy reconstitution
  • Fast Shipping – Most orders ship same day. We offer flat rate shipping and 2-3 day delivery in the USA

Click the “Add To Cart” button to grab your Follistatin-344 today!

Research Use Only

This product is intended strictly for laboratory research purposes. Not for human consumption, clinical use, veterinary applications, or any diagnostic or therapeutic purposes.

Follistatin-344 Research & Scientific Overview

Jump to: Structure | Mechanism | Studies | Pharmacokinetics | Protocols | Limitations | Lead Researcher | References

Follistatin-344 Molecular Structure & Chemical Properties

Follistatin-344 peptide represents a synthetic analogue of naturally occurring human follistatin, a protein discovered in porcine ovarian follicular fluid during the 1980s while investigating follicle-stimulating hormone regulation. This glycoprotein has emerged as one of the most extensively studied myostatin inhibitors in preclinical muscle biology research, with investigations spanning from rodent models to non-human primates demonstrating its remarkable capacity to promote muscle hypertrophy. The “344” designation refers to the amino acid sequence of the precursor molecule, which undergoes post-translational modification to produce the circulating FS-315 isoform. Unlike the tissue-bound FS-288 variant, Follistatin-344 generates a soluble, serum-circulating form that demonstrates reduced heparin-binding affinity, potentially minimizing off-target effects on reproductive tissues while maintaining potent myostatin-neutralizing activity.

2D molecular structure (Source: PubChem)

Technical Specifications

Property Value
CAS Number 117628-82-7
Molecular Formula C1350H2153N405O433S39 (subscripted)
Molecular Weight 3780 g/mol
Amino Acid Sequence MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Half-Life (Plasma) 90-130 minutes (rat models; native FST-315)
Stability Stable in lyophilized form at -20 degrees C
Solubility Water soluble; compatible with physiological saline solutions
Storage Lyophilized: -20 degrees C; Reconstituted: 2-8 degrees C

The protein structure contains three distinct follistatin domains (FS1, FS2, FS3) featuring EGF-like and kazal-like motifs, with FS1 and FS2 being most critical for activin and myostatin binding. The molecule is unusually rich in cysteine residues, contributing to its structural stability through multiple disulfide bonds.

Follistatin-344 Mechanism of Action

Follistatin-344 peptide functions primarily as a high-affinity binding protein that neutralizes members of the TGF-beta superfamily, effectively removing growth-limiting signals from circulation and tissue environments. Rather than activating specific cellular receptors, this glycoprotein operates through a sequestration mechanism, capturing target proteins before they can engage their cognate receptors on cell surfaces. Current research suggests that myostatin inhibition serves as the primary driver of its muscle-enhancing effects, supported by additional regulatory effects on activin signaling, follicle-stimulating hormone modulation, and potential interactions with bone morphogenetic proteins.

Primary Cellular Pathways

Myostatin Neutralization – Muscle Growth Disinhibition

Follistatin-344 demonstrates exceptionally high binding affinity for myostatin, a negative regulator of skeletal muscle mass encoded by the MSTN gene[1]. This mechanism involves:

  • Direct protein-protein binding that prevents myostatin from engaging activin type II receptors on muscle cells
  • Blockade of downstream SMAD2/3 phosphorylation, removing transcriptional repression of myogenic genes
  • Enhanced myoblast proliferation and differentiation when myostatin signaling is neutralized
  • Both muscle fiber hypertrophy (increased fiber size) and hyperplasia (increased fiber number) in animal models

Research in myostatin-knockout mice combined with follistatin overexpression demonstrated quadruple the muscle mass of controls, suggesting follistatin acts through pathways extending beyond myostatin inhibition alone[2].

Activin A and B Sequestration – Anti-Catabolic Effects

Beyond myostatin, Follistatin-344 peptide potently binds activin proteins, which play regulatory roles in muscle catabolism, metabolism, and inflammatory responses[3]. Key effects include:

  • Neutralization of activin A and activin B, preventing their pro-catabolic signaling
  • Reduction in muscle protein degradation pathways activated by activins
  • Modulation of metabolic responses including glucose and lipid metabolism
  • Potential anti-fibrotic effects through activin pathway suppression

Studies suggest the dual inhibition of both myostatin and activins may provide superior muscle preservation compared to myostatin inhibition alone, particularly in disease states characterized by muscle wasting[4].

Follicle-Stimulating Hormone Suppression

Follistatin-344 was originally identified for its capacity to suppress pituitary secretion of follicle-stimulating hormone (FSH)[5]. While not directly related to muscle effects:

  • FS-344 binds to and neutralizes FSH, preventing excessive follicular stimulation
  • The FS-315 isoform (generated from FS-344) shows reduced affinity for ovarian tissues compared to FS-288
  • This selectivity profile contributed to FS-344’s selection for muscle-targeted gene therapy approaches
  • Minimal reproductive effects observed in long-term animal studies using FS-344

Bone Morphogenetic Protein Interactions

Emerging research indicates Follistatin-344 may interact with bone morphogenetic proteins (BMPs), members of the TGF-beta superfamily involved in tissue development[6]:

  • Potential binding to BMP-6 and BMP-7, modulating their bioavailability
  • Possible regulatory effects on bone formation and mineralization
  • Suggested involvement in tissue repair processes beyond muscle
  • Mechanisms incompletely characterized and requiring further investigation
Key Mechanistic Insight: Follistatin-344’s broad-spectrum TGF-beta superfamily binding distinguishes it from highly selective myostatin antibodies, potentially enabling more comprehensive modulation of growth-limiting pathways. However, this promiscuity also raises questions about unintended off-target effects that remain inadequately studied.

Follistatin-344 Research Applications & Key Findings

Skeletal Muscle Research

Myostatin Inhibition and Muscle Hypertrophy

Extensive preclinical research has established Follistatin-344 as a potent inducer of muscle growth across multiple species and experimental paradigms. Key findings from animal studies include[7]:

  • Dramatic muscle mass increases in transgenic mice overexpressing follistatin (194-327% increase compared to controls)
  • 66% increase in muscle fiber number and 28% increase in fiber diameter in follistatin transgenic models
  • Muscle growth comparable to myostatin-knockout mice, validating follistatin’s role as a functional myostatin antagonist
  • Effects observed across multiple muscle groups including quadriceps, tibialis anterior, gastrocnemius, and triceps

Single-dose gene therapy studies using AAV1-FS-344 demonstrated sustained muscle mass enhancement for over 2 years in both wildtype and dystrophic mice[8].

Muscular Dystrophy Models

Research in mdx mice (Duchenne muscular dystrophy model) revealed therapeutic potential for muscle-wasting diseases[9]:

  • 15-fold increase in serum follistatin with high-dose AAV1-FS-344 administration
  • Improved muscle mass and reduced pathological features in dystrophic muscles
  • Functional improvements in grip strength and motor performance
  • Benefits observed even when treatment initiated in aged (6.5-month-old) dystrophic animals

Studies in nonhuman primates demonstrated 15-20% muscle size increases with AAV1-FS-344 gene transfer, with improvements persisting for 15 months post-injection[10].

Spinal Muscular Atrophy Research

Investigations in SMA mouse models showed follistatin’s effects extend to neuromuscular disease[11]:

  • Increased muscle mass and improved motor function in SMA mice
  • 30% lifespan extension compared to untreated SMA controls
  • Preservation of spinal motor neurons through positive feedback mechanisms
  • Enhanced survival of both muscle tissue and neural components

Tissue Repair and Regeneration Studies

Liver Fibrosis and Regeneration

Research examined follistatin’s effects on hepatic injury and repair processes[12]:

  • 32% reduction in liver fibrosis in rat models of early fibrotic disease
  • Nearly 90% decrease in hepatocyte apoptosis in follistatin-treated animals
  • Accelerated liver regeneration following partial hepatectomy
  • Accumulation in liver tissue following intravenous administration

Pharmacokinetic studies showed approximately 9% of infused follistatin remained in liver at 2 hours, with elevated levels persisting for 72 hours[13].

Cancer Research – Complex and Context-Dependent

Studies investigating follistatin’s relationship with cancer have yielded mixed findings requiring careful interpretation[14]:

  • Under-expression of follistatin observed in some breast cancer models, correlating with increased metastatic potential
  • Potential protective effects against esophageal cancer by modulating BMP signaling
  • Context-dependent effects varying by cancer type and tissue environment
  • Theoretical concerns about promoting cell proliferation requiring further investigation
Critical Research Limitation: Despite promising preclinical data across multiple organ systems, human clinical trials remain extremely limited. Only one published Phase 1/2a trial exists (Becker muscular dystrophy), with no peer-reviewed data on safety or efficacy in healthy humans. All muscle-building claims are extrapolated from animal studies and cannot be assumed to translate to humans.

Follistatin-344 Pharmacokinetics & Metabolism

Absorption & Distribution

Follistatin-344 demonstrates highly unusual pharmacokinetic properties for a large glycoprotein, particularly regarding tissue distribution and systemic bioavailability. Following administration in experimental models[15]:

  • Rapid systemic distribution following intramuscular gene therapy delivery, with both local and distant muscle effects
  • Preferential accumulation in hepatic tissue following intravenous administration (approximately 9% retained at 2 hours)
  • Gene therapy vectors (AAV1-FS-344) provide sustained expression, with elevated serum levels detectable for 15+ months after single injection
  • Peptide formulations show poor systemic bioavailability compared to gene therapy approaches

The FS-315 isoform (produced from FS-344 precursor) functions as the predominant circulating form in serum, with reduced heparin-binding affinity minimizing tissue sequestration compared to the FS-288 variant[16].

Metabolism & Elimination

The metabolic fate and clearance of native follistatin proteins has been characterized in animal models, revealing extremely rapid turnover[17]:

  • Plasma half-life of 90-130 minutes for native FST-315 in rats (biexponential clearance: initial t1/2 = 4 minutes, terminal t1/2 = 130.8 minutes)
  • Rapid hepatic clearance represents primary elimination route
  • Protein engineering studies developed Fc-fusion variants with 100-fold increased half-life and 1600-fold increased exposure
  • Standard black-market peptide preparations likely exhibit similarly short half-lives (approximately 90 minutes reported)

A significant paradox exists in gene therapy applications: despite the short half-life of circulating follistatin protein, AAV-mediated gene transfer produces sustained biological effects lasting months to years, suggesting continuous endogenous production from transduced muscle tissue.

Excretion Pathways

Limited data exist characterizing specific excretion mechanisms for follistatin[18]:

  • Likely proteolytic degradation followed by renal clearance of peptide fragments
  • Hepatic uptake and metabolism contribute substantially to clearance
  • No accumulation detected in chronic dosing studies in animal models
  • Detection in urine samples possible for anti-doping testing purposes (up to 48 hours post-administration)

Current anti-doping methodologies can distinguish exogenously administered follistatin (typically containing His-tags and lacking proper glycosylation) from endogenous follistatin through immunoblotting techniques[19].

Follistatin-344 Research Protocols & Administration

Dosing in Published Research

Preclinical investigations have employed Follistatin-344 across a wide range of doses depending on species, delivery method, and experimental objectives:

  • Mouse studies: 1 x 10^11 viral particles per animal for gene therapy (AAV1-FS-344); equivalent to approximately 4-5 x 10^12 vg/kg body weight
  • Rat models: 1 microgram intravenous bolus for pharmacokinetic studies
  • Macaque studies: Intramuscular AAV1-FS-344 gene therapy at doses producing 15-20% muscle mass increases
  • Peptide formulations: Black market products reportedly used at 50-100 mcg per day in uncontrolled human self-experimentation

Important: These are experimental doses used in animal studies and cannot be extrapolated to other species due to profound differences in metabolism, receptor expression patterns, pharmacokinetic parameters, and follistatin degradation rates between species. Gene therapy approaches produce fundamentally different exposure profiles compared to exogenous peptide administration.

Administration Routes in Research

Multiple delivery methods have been investigated for follistatin administration:

  • Gene therapy (AAV1-FS-344) – Primary approach in formal clinical research; single intramuscular injection producing long-term transgene expression
  • Intravenous injection – Used in pharmacokinetic characterization studies and liver regeneration research
  • Intramuscular injection – Applied in gene therapy protocols and direct muscle-targeted studies
  • Subcutaneous injection – Reported in uncontrolled human self-experimentation; bioavailability poorly characterized
  • Local tissue injection – Investigated for tissue-specific applications in research models

Common Model Organisms

Follistatin-344 has been studied across diverse experimental systems:

  • Mice – Primary preclinical model (C57BL/6, mdx dystrophic mice, SMA models); majority of mechanistic and efficacy data
  • Rats – Pharmacokinetic studies, liver regeneration research, tissue distribution investigations
  • Cynomolgus macaques – Non-human primate validation; critical translational research demonstrating efficacy and long-term safety
  • Pigs – Transgenic models demonstrating follistatin effects on muscle mass and body composition in livestock
  • Cell culture – Myoblasts, satellite cells, K562 cells for activin neutralization assays, various tissue-specific cell lines

Research Limitations & Regulatory Status

Critical Gaps in Current Evidence

Despite over two decades of preclinical investigation and growing interest from the performance-enhancement community, Follistatin-344 faces substantial barriers to legitimate clinical application and possesses significant knowledge gaps that limit its research utility.

Lack of Human Clinical Data

The most critical limitation is the near-complete absence of published human clinical data:

  • Only one published Phase 1/2a clinical trial exists: AAV1-FS-344 gene therapy in six patients with Becker muscular dystrophy[20]
  • No peer-reviewed data on Follistatin-344 peptide administration in healthy humans
  • Human safety profile for peptide formulations completely unestablished
  • Optimal dosing, administration frequency, and treatment duration unknown in humans
  • Long-term safety beyond 2-3 years unstudied even in animal models

Multiple clinical trials investigating follistatin for various conditions (cardiovascular disease, polycystic ovarian syndrome, prostate cancer) have been initiated but lack published results, limiting interpretation of human applicability.

Mechanistic Understanding Gaps

Fundamental aspects of follistatin biology remain incompletely characterized:

  • Precise binding affinities for different TGF-beta superfamily members under physiological conditions inadequately defined
  • Tissue-specific effects and distribution patterns in humans unknown
  • Relationship between circulating follistatin levels and biological outcomes poorly understood
  • Potential for differential effects based on genetic background or disease state unexplored
  • Off-target effects beyond intended myostatin/activin inhibition inadequately studied

Long-Term Safety Considerations

Critical safety questions remain unanswered, particularly for chronic use scenarios:

  • Effects on reproductive function inadequately studied despite FSH-suppressing activity
  • Cancer risk from long-term growth signal modulation completely uncharacterized in humans
  • Potential for disproportionate growth of cardiac muscle or other non-skeletal tissues unstudied
  • Interaction potential with medications and other supplements unknown
  • Black market preparations often contaminated (only 9 of 17 tested products actually contained follistatin)[21]

Cases of vision disturbances (central serous chorioretinopathy) have been anecdotally reported in association with underground follistatin use, though causality remains unestablished.

Regulatory & Competitive Sport Status

FDA Position

Follistatin-344 has not received FDA approval for any indication:

  • Classified as an unapproved and investigational substance
  • Not recognized as Generally Recognized as Safe (GRAS)
  • Not approved for human medical use or veterinary applications
  • Not legally available for medical compounding in the United States
  • Black market sources explicitly violate FDA regulations and often contain adulterated or mislabeled products

One gene therapy formulation (AAV1-FS-344) has been used in investigational clinical trials under FDA oversight, but peptide formulations have no regulatory authorization.

WADA Prohibition

The World Anti-Doping Agency explicitly prohibits follistatin under its banned substances list:

  • Listed under Section S4.4 (Hormone and Metabolic Modulators – Agents preventing activin receptor IIB activation)
  • Prohibited at all times (both in-competition and out-of-competition)
  • Includes all forms: “Myostatin inhibitors such as agents reducing or ablating myostatin expression; Myostatin-binding proteins (e.g. follistatin)”
  • No Therapeutic Use Exemptions (TUEs) available
  • Detection methods validated and deployed in anti-doping laboratories worldwide[22]

WADA’s prohibition reflects both the performance-enhancing potential and the complete absence of approved medical use for follistatin products.

Research Classification: Follistatin-344 is available only for laboratory research use. It is not intended for human consumption, medical use, veterinary applications, or performance enhancement. All research must be conducted under appropriate ethical oversight and regulatory compliance with institutional review board approval where applicable.

Lead Researcher Spotlight

Dr. Louise Rodino-Klapac, PhD

President, R&D and Technical Operations

Sarepta Therapeutics, Cambridge, Massachusetts

Formerly: Principal Investigator, Center for Gene Therapy, Nationwide Children’s Hospital

Dr. Louise Rodino-Klapac is a pioneering figure in gene therapy research for neuromuscular diseases and has been instrumental in advancing follistatin-based therapeutic approaches from preclinical research to human clinical trials. Her laboratory at Nationwide Children’s Hospital conducted seminal studies establishing AAV1-FS-344 as the optimal follistatin variant for gene therapy applications, demonstrating its superior muscle-enhancing effects compared to other myostatin inhibitors while maintaining an acceptable safety profile across multiple animal species.

Dr. Rodino-Klapac’s research contributions include:

  • Principal investigator for the Phase 1/2a clinical trial of AAV1-FS-344 gene therapy in Becker muscular dystrophy patients
  • Comparative studies establishing FS-344’s superiority over FS-288, FLRG, and GASP-1 for muscle-targeted applications
  • Long-term safety and efficacy studies in wildtype and dystrophic mice demonstrating sustained benefits for over 2 years
  • Demonstration of follistatin gene therapy efficacy in non-human primates, a critical translational milestone
  • Co-invention of multiple gene therapy approaches for limb-girdle muscular dystrophies and Duchenne muscular dystrophy

Her work has resulted in 11 investigational new drug (IND) applications for gene therapy and numerous field-advancing peer-reviewed publications that established the scientific foundation for follistatin as a therapeutic agent.

Disclaimer: This spotlight is provided for educational purposes to acknowledge scientific contributions to Follistatin-344 research. Cenexa Labs has no affiliation with Dr. Rodino-Klapac, Sarepta Therapeutics, or Nationwide Children’s Hospital, and this information does not constitute an endorsement of any products or services.

References

  1. Lee, S.J., & McPherron, A.C. (2001). Regulation of myostatin activity and muscle growth. Proceedings of the National Academy of Sciences, 98(16), 9306-9311. PubMed
  2. Lee, S.J. (2007). Quadrupling muscle mass in mice by targeting TGF-beta signaling pathways. PLoS One, 2(8), e789. PubMed
  3. Seiwerth, S., Rucman, R., Turkovic, B., Sever, M., Klicek, R., Radic, B., Drmic, D., Stupnisek, M., Misic, M., Vuletic, L.B., & Sikiric, P. (2018). BPC 157 and standard angiogenic growth factors. Current Pharmaceutical Design, 24(18), 1972-1989. PubMed
  4. Castonguay, R., Lachey, J., Wallner, S., Strand, J., Liharska, K., Watanabe, A.E., Cannell, M., Davies, M.V., Sako, D., Troy, M.E., Krishnan, L., Mulivor, A.W., Li, H., Keates, S., Alexander, M.J., Pearsall, R.S., & Kumar, R. (2019). Follistatin-288-Fc fusion protein promotes localized growth of skeletal muscle. Journal of Pharmacology and Experimental Therapeutics, 368(3), 435-445. PubMed
  5. Ueno, N., Ling, N., Ying, S.Y., Esch, F., Shimasaki, S., & Guillemin, R. (1987). Isolation and partial characterization of follistatin: a single-chain Mr 35,000 monomeric protein that inhibits the release of follicle-stimulating hormone. Proceedings of the National Academy of Sciences, 84(23), 8282-8286. PubMed
  6. Cash, J.N., Angerman, E.B., Kattamuri, C., Nolan, K., Zhao, H., Sidis, Y., Keutmann, H.T., & Thompson, T.B. (2012). Structure of myostatin-follistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding. Journal of Biological Chemistry, 287(2), 1043-1053. PubMed
  7. Lee, S.J., & McPherron, A.C. (1999). Myostatin and the control of skeletal muscle mass. Current Opinion in Genetics & Development, 9(5), 604-607. PubMed
  8. Haidet, A.M., Rizo, L., Handy, C., Umapathi, P., Eagle, A., Shilling, C., Boue, D., Martin, P.T., Sahenk, Z., Mendell, J.R., & Kaspar, B.K. (2008). Long-term enhancement of skeletal muscle mass and strength by single gene administration of myostatin inhibitors. Proceedings of the National Academy of Sciences, 105(11), 4318-4322. PubMed
  9. Haidet, A.M., Rizo, L., Handy, C., Umapathi, P., Eagle, A., Shilling, C., Boue, D., Martin, P.T., Sahenk, Z., Mendell, J.R., & Kaspar, B.K. (2008). Long-term enhancement of skeletal muscle mass and strength by single gene administration of myostatin inhibitors. Proceedings of the National Academy of Sciences, 105(11), 4318-4322. PubMed
  10. Kota, J., Handy, C.R., Haidet, A.M., Montgomery, C.L., Eagle, A., Rodino-Klapac, L.R., Tucker, D., Shilling, C.J., Therlfall, W.R., Walker, C.M., Weisbrode, S.E., Janssen, P.M., Clark, K.R., Sahenk, Z., Mendell, J.R., & Kaspar, B.K. (2009). Follistatin gene delivery enhances muscle growth and strength in nonhuman primates. Science Translational Medicine, 1(6), 6ra15. PubMed
  11. Rose, F.F., Mattis, V.B., Rindt, H., & Lorson, C.L. (2009). Delivery of recombinant follistatin lessens disease severity in a mouse model of spinal muscular atrophy. Human Molecular Genetics, 18(6), 997-1005. PubMed
  12. Kogure, K., Zhang, Y.Q., Kanzaki, M., Omata, W., Mine, T., & Kojima, I. (2000). Intravenous administration of follistatin: delivery to the liver and effect on liver regeneration after partial hepatectomy. Hepatology, 32(5), 970-976. PubMed
  13. Kogure, K., Zhang, Y.Q., Kanzaki, M., Omata, W., Mine, T., & Kojima, I. (2000). Intravenous administration of follistatin: delivery to the liver and effect on liver regeneration after partial hepatectomy. Hepatology, 32(5), 970-976. PubMed
  14. Shi, L., Resaul, J., Owen, S., Ye, L., & Jiang, W.G. (2016). Clinical and therapeutic implications of follistatin in solid tumours. Cancer Genomics & Proteomics, 13(6), 425-435. PubMed
  15. Kota, J., Handy, C.R., Haidet, A.M., Montgomery, C.L., Eagle, A., Rodino-Klapac, L.R., Tucker, D., Shilling, C.J., Therlfall, W.R., Walker, C.M., Weisbrode, S.E., Janssen, P.M., Clark, K.R., Sahenk, Z., Mendell, J.R., & Kaspar, B.K. (2009). Follistatin gene delivery enhances muscle growth and strength in nonhuman primates. Science Translational Medicine, 1(6), 6ra15. PubMed
  16. Schneyer, A.L., Wang, Q., Sidis, Y., & Sluss, P.M. (2004). Differential distribution of follistatin isoforms: application of a new FS315-specific immunoassay. Journal of Clinical Endocrinology & Metabolism, 89(10), 5067-5075. PubMed
  17. Datta-Mannan, A., Yaden, B., Krishnan, V., Jones, B.E., & Croy, J.E. (2013). An engineered human follistatin variant: insights into the pharmacokinetic and pharmacodynamic relationships of a novel molecule with broad therapeutic potential. Journal of Pharmacology and Experimental Therapeutics, 344(3), 616-623. PubMed
  18. Kogure, K., Zhang, Y.Q., Kanzaki, M., Omata, W., Mine, T., & Kojima, I. (2000). Intravenous administration of follistatin: delivery to the liver and effect on liver regeneration after partial hepatectomy. Hepatology, 32(5), 970-976. PubMed
  19. Reichel, C., Gmeiner, G., & Thevis, M. (2019). Detection of black market follistatin 344. Drug Testing and Analysis, 11(11-12), 1695-1707. PubMed
  20. Al-Zaidy, S.A., Sahenk, Z., Rodino-Klapac, L.R., Kaspar, B., & Mendell, J.R. (2015). Follistatin gene therapy improves ambulation in Becker muscular dystrophy. Journal of Neuromuscular Diseases, 2(3), 185-192. PubMed
  21. Reichel, C., Gmeiner, G., & Thevis, M. (2019). Detection of black market follistatin 344. Drug Testing and Analysis, 11(11-12), 1695-1707. PubMed
  22. Reichel, C., Gmeiner, G., & Thevis, M. (2019). Detection of black market follistatin 344. Drug Testing and Analysis, 11(11-12), 1695-1707. PubMed

All references open in new window. These citations are provided for educational and research purposes only. This information is not intended to diagnose, treat, cure, or prevent any disease. Follistatin-344 is intended for laboratory research use only.

The Cenexa Labs Gold Standard

Most peptide sites simply resell vials from overseas labs with little oversight or testing (Much of it is either fake or laced with contaminants). At Cenexa Labs, we manufacture our own peptides under strict USA-based standards…right here IN THE USA. From synthesis to lyophilization to final vial, every step is handled under our direct control — so you never have to question what you’re getting.

We might not be the cheapest, but you can count on our peptides being 100% legit and free from contaminants, heavy metals and toxins.

Why Researchers Choose Cenexa Labs

  • End-to-End Chain of Custody: Every batch is logged, tested, and traceable — no middlemen, no relabeling, no guesswork.
  • Lot-Linked COAs: Each vial’s lot number ties directly to third-party HPLC/MS results. No recycled or generic COAs.
  • We’re the Manufacturer: Because we produce in-house, we control purity, potency, and compliance — instead of reselling from anonymous overseas labs.
  • Verified Purity, Every Time: 99%+ purity confirmed on every batch by independent labs, not just claimed on a label.
  • GMP-Aligned, USA Based: Manufactured domestically in controlled GMP, ISO 9001-audited facilities.
  • Fast, Reliable Fulfillment: Orders placed by 2pm CST ship the same business day. Free USPS Priority on orders $300+. $9.95 Flat rate shipping on all other orders with 2-3 day delivery.
  • Backed by Trust: Over 18,000 researchers nationwide rely on Cenexa Labs for consistent, verifiable peptides.
  • Room Temperature (Unmixed): Lyophilized (powder) peptides are stable for 3–4 months at room temperature if kept sealed and away from direct light.
  • Freezer (Unmixed): For long-term storage, place vials in a freezer. Depending on temperature, peptides can remain stable for 1–3 years.
  • After Reconstitution: Once mixed with bacteriostatic water, peptides must be stored in the refrigerator and remain stable for up to 30 days.

All Cenexa peptides are manufactured 100% end-to-end here in the USA using the Lyophilization (Freeze Drying) process. This ensures maximum stability and quality.

Best Practice:
Only reconstitute your peptides when you’re ready to begin using them. Until then, keep vials in their lyophilized powder form, stored in the freezer and away from light.

Fast Processing: We strive to ship same-day. During high-volume times it may take 2–3 days for your package to enter the mailstream. (You’ll see a notice at checkout and can upgrade if you need guaranteed same-day shipping.)

  • Flat Rate Shipping: $9.95 on all orders (USPS Priority Mail 2–3 days).
  • Free Shipping: Orders over $300 ship free.
  • Expedited Options: Faster methods available at checkout.

Important: Orders paid by eCheck won’t ship until payment clears our bank (usually 2–3 business days after it leaves your account).

All products are carefully packaged for safe arrival.

Need help with your order or delivery?

See What Some Of Our 18,000+ Happy Customers Have To Say…

Scroll to Top
0