Availability: In Stock

GLP3 + Cagrilintide

$174.99

GLP3 + Cagrilintide Blend Peptide combines a triple-action metabolism regulator with an appetite-control peptide, studied for advanced obesity and diabetes research.

PointsEarn $8 Cenexa Bucks when you buy this product!

Availability: In Stock

A portion of every order supports organizations focused on children’s cancer research & care. Help us make a difference.

Buy More & Save!

Add selected quantity to cart above & discount is automatically applied.

Quantity Discount % Price Per Item
3-6 4 $167.99
7-9 7 $162.74
10-50 9 $159.24

GLP2 + Cagrilintide Blend Peptide

The Four-Pathway Metabolic Research Compound

Also known as: GLP3/Cagri Blend, Lean Blend, CagriGLP3

Why Researchers Choose GLP3 + Cagrilintide Blend Peptide

Unlike single or dual-pathway peptides, this blend targets four distinct metabolic receptors—combining GLP3’s triple incretin action (GLP-1, GIP, and glucagon receptors) with Cagrilintide’s amylin pathway activation. This makes it uniquely valuable for researchers studying comprehensive metabolic regulation, allowing investigation of both incretin-dependent and incretin-independent appetite control mechanisms in a single model. When researchers need to understand how multiple hormonal pathways interact synergistically, this blend provides the most complete picture currently available.

What It Is

This research peptide blend combines two advanced synthetic peptides: GLP3 (a 39-amino acid triple agonist) and Cagrilintide (a long-acting amylin analog). GLP3 peptide was engineered from a GIP peptide backbone to simultaneously activate GLP-1, GIP, and glucagon receptors, while Cagrilintide peptide is a modified amylin analog designed with enhanced stability to resist the fibrillation that makes native amylin challenging to work with.

Researchers became interested in this combination because early studies suggested that adding amylin pathway modulation to triple incretin agonism could produce synergistic effects beyond either component alone – similar to how the CagriSema (cagrilintide + GLP1) combination outperformed individual components in clinical trials.

How It Works (What Makes It Interesting)

This peptide blend modulates metabolic function through complementary mechanisms:

GLP-1 Receptor Activation (GLP3 component) – Stimulates insulin secretion from pancreatic beta cells in a glucose-dependent manner and delays gastric emptying, activating the cAMP-PKA signaling cascade that increases insulin release by 3-5 fold in preclinical models

GIP Receptor Activation (GLP3 component) – Enhances insulin sensitivity and influences lipid metabolism by activating adipocyte receptors, with studies showing 15-20% reductions in triglyceride levels in rodent obesity models

Glucagon Receptor Activation (GLP3 component) – Promotes energy expenditure and hepatic glucose output while stimulating fatty acid oxidation, creating a catabolic energy balance that contributes to fat mass reduction even under calorie-neutral conditions

Amylin Receptor Activation (Cagrilintide component) – Acts through AMY1R and AMY3R (heterodimeric complexes of calcitonin receptor with RAMP1/RAMP3) in the hypothalamus and brainstem to induce satiety through pathways distinct from incretin hormones, slowing gastric emptying and suppressing glucagon secretion

Synergistic Pathway Integration – The combination targets both homeostatic (hypothalamic) and hedonic (reward-system) appetite control centers, with the amylin component potentially reinforcing satiety signals that GLP-1 activation alone might not fully address

Common Research Applications

Obesity Models and Energy Balance Studies: Diet-induced obesity models, appetite suppression mechanisms, food intake regulation, energy expenditure measurement, body composition analysis

Metabolic Syndrome Research: Insulin resistance studies, glucose homeostasis investigation, lipid metabolism analysis, triglyceride regulation, VLDL metabolism

Comparative Peptide Pharmacology: Multi-receptor agonist comparison studies, incretin vs non-incretin pathway analysis, synergistic mechanism investigation, receptor selectivity research, dose-response characterization

Hepatic Metabolism Studies: Non-alcoholic fatty liver disease (NAFLD) models, hepatic glucose output regulation, liver fat accumulation, lipid oxidation pathways

Neuroendocrine Pathway Research: Hypothalamic satiety center investigation, brainstem appetite regulation (area postrema, nucleus of the solitary tract), neural activation patterns, neuropeptide Y/AGRP pathway studies

Type 2 Diabetes Research: Beta-cell preservation studies, glycemic control mechanisms, HbA1c reduction models, glucagon suppression, glucose-dependent insulin secretion

Cardiovascular and Cardiometabolic Research: Blood pressure regulation, cardiovascular risk factor modification, lipid profile changes, systemic metabolic improvements

What You’re Getting

Every batch of our GLP3 + Cagrilintide Blend Peptide meets rigorous research standards:

  • Exceeds 99% Purity – Verified by HPLC analysis
  • Certificate of Analysis (COA) – Included with every order, showing purity and identity confirmation
  • Endotoxin-Free – Tested to ensure <1 EU/mg for cell culture applications
  • Manufactured in USA – GMP-certified facilities with full traceability
  • Sterile & Lyophilized – Stable for long-term storage, easy reconstitution
  • Fast Shipping – Most orders ship same day. We offer flat rate shipping and 2-3 day delivery in the USA

Click the “Add To Cart” button to grab your GLP3 + Cagrilintide Blend Peptide today!

Research Use Only

This product is intended strictly for laboratory research purposes. Not for human consumption, clinical use, veterinary applications, or any diagnostic or therapeutic purposes.

GLP3 + Cagrilintide Blend Research & Scientific Overview

Jump to: Structure | Mechanism | Studies | Pharmacokinetics | Protocols | Limitations | Lead Researcher | References

GLP3 + Cagrilintide Blend Molecular Structure & Chemical Properties

GLP3 + Cagrilintide Peptide Blend represents an innovative synergistic combination of two extensively studied metabolic peptides developed to provide comprehensive appetite regulation and weight management effects in preclinical research models. This peptide formulation combines GLP3, a triple receptor agonist targeting GLP-1, GIP, and glucagon receptors, with cagrilintide, a long-acting amylin analog, creating a dual-mechanism research tool that addresses metabolic dysfunction through complementary pathways. The blend leverages the multi-receptor activation of GLP3 with the satiety-enhancing and gastric-slowing effects of cagrilintide, providing researchers with a comprehensive approach to investigating appetite control, energy expenditure, and glucose metabolism.

Chemical Composition

GLP3 and Cagrilintide peptide blend component peptides molecular structure
GLP3 and Cagrilintide Peptide Blend Molecular Structure

Representative component structure (Cagrilintide) – blend contains two distinct peptides (Source: PubChem)

Technical Specifications

Property Value
Primary Components GLP3, Cagrilintide
CAS Number GLP3: 2381089-83-2; Cagrilintide: 1415456-99-3
Molecular Formula GLP3: C221H342N46O68; Cagrilintide: C194H312N54O59S2
Molecular Weight GLP3: 4731.33 g/mol; Cagrilintide: 4409.01 g/mol; Combined: ~9,140 g/mol
Amino Acid Sequence GLP3: 39 amino acid peptide with GIP backbone, modified with Aib2, alpha-MeLeu13, Aib20, C20 fatty diacid conjugation; Cagrilintide: Eicosanedioic acid-gamma-Glu-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (disulfide bridge: Cys3-Cys8)
Half-Life (Plasma) GLP3: ~6 days; Cagrilintide: ~120-165 hours
Stability Room temperature stable (lyophilized); both components lipidated for extended half-life
Solubility Water soluble; reconstitutes in bacteriostatic water or saline
Storage Lyophilized: -20 degrees C; Reconstituted: 2-8 degrees C

The blend combines two advanced peptide classes: a triple incretin receptor agonist (GLP3) with an acylated amylin analog (cagrilintide), creating a multifaceted research tool targeting both incretin-based pathways and amylin-mediated satiety mechanisms simultaneously.

GLP3 + Cagrilintide Blend Peptide Mechanism of Action

GLP3 + Cagrilintide Blend Peptide exerts its biological effects through complementary but distinct molecular pathways that work synergistically to promote appetite suppression, enhance metabolic regulation, and improve glucose homeostasis. Rather than targeting a single pathway, this peptide combination activates multiple interconnected signaling networks across incretin and amylin receptor systems that collectively enhance metabolic responses beyond what individual components might achieve alone.

Primary Cellular Pathways

Triple Incretin Receptor Activation – Metabolic Regulation

GLP3 functions as a triple agonist simultaneously activating GLP-1R, GIPR, and GCGR with distinct potency profiles[1]. This multi-receptor activation enables:

  • GLP-1R activation enhances glucose-dependent insulin secretion and reduces appetite through hypothalamic signaling
  • GIPR activation (highest potency: EC50 0.0643 nM) promotes insulin secretion and modulates lipid metabolism
  • GCGR activation (EC50 5.79 nM) increases energy expenditure and promotes hepatic fat oxidation
  • Combined receptor engagement produces dose-dependent reductions in body weight and improvements in glycemic control

Research demonstrates that GLP3s balanced activation across three receptors produces superior metabolic effects compared to single or dual agonists, with phase 2 trials showing up to 24.2% weight reduction in 48 weeks[2].

Amylin and Calcitonin Receptor Pathway – Satiety Enhancement

Cagrilintide acts as a nonselective agonist of amylin receptors (AMY1R, AMY2R, AMY3R) and calcitonin receptor (CTR), mimicking the satiety-inducing effects of endogenous amylin[3]. Key mechanisms include:

  • Activation of neurons in the area postrema and nucleus tractus solitarius in the brainstem
  • Enhanced satiety signaling through distinct pathways from GLP-1 mechanisms
  • Slowed gastric emptying via calcitonin receptor-mediated effects
  • Reduced food reward signaling and decreased “food noise” through central appetite centers

Studies in knockout mouse models confirmed that cagrilintide’s weight loss effects depend specifically on AMY1R and AMY3R presence, demonstrating receptor-specific mechanisms⁴.

Gastric Emptying Modulation – Dual Pathway Effect

Both components contribute to delayed gastric emptying through complementary mechanisms[5]:

  • GLP3 delays gastric emptying primarily through GLP-1R and glucagon receptor pathways
  • Cagrilintide slows gastric transit through amylin and calcitonin receptor activation
  • Combined effects produce more sustained gastric delay than single agents
  • Prolonged nutrient exposure in the small intestine enhances incretin release

This dual-pathway gastric slowing mechanism may explain enhanced satiety and reduced caloric intake observed in combination studies.

Energy Expenditure and Thermogenesis

GLP3’s glucagon receptor activation specifically contributes to increased energy expenditure through multiple pathways[6]:

  • Enhanced hepatic fatty acid oxidation and lipolysis
  • Increased thermogenic activity in brown adipose tissue
  • Upregulation of uncoupling protein expression
  • Potential FGF21-mediated metabolic effects

This thermogenic component distinguishes the blend from pure GLP-1 or amylin-based approaches, addressing both energy intake (via satiety) and energy expenditure simultaneously.

Glucose Homeostasis and Insulin Secretion

The blend provides comprehensive glucose regulation through multiple mechanisms[7]:

  • Glucose-dependent insulin secretion enhanced through both GLP-1R and GIPR activation
  • Glucagon suppression during hyperglycemia via GLP-1R signaling
  • Reduced postprandial glucose excursions through delayed gastric emptying
  • Improved insulin sensitivity resulting from weight reduction and metabolic improvements

Research demonstrates that the combination approach achieves HbA1c reductions exceeding 2% in type 2 diabetes models while maintaining favorable hypoglycemia risk profiles.

Synergistic Mechanism: The GLP3 + Cagrilintide Blend’s dual-pathway approach activates both incretin-based metabolism (GLP-1, GIP, glucagon) and amylin-mediated satiety pathways simultaneously. This comprehensive mechanism addresses appetite, energy expenditure, gastric function, and glucose homeostasis through distinct but complementary receptor systems, potentially explaining enhanced efficacy observed in combination approaches compared to monotherapies.

GLP3 + Cagrilintide Blend Research Applications & Key Findings

Obesity and Weight Management Research

Weight Reduction Studies

Research investigating individual components and combination approaches has demonstrated significant effects on body weight across multiple models[8]. Key findings include:

  • GLP3 monotherapy achieved 22.8-24.2% mean weight reduction at 48 weeks in phase 2 obesity trials (8-12 mg doses)
  • Cagrilintide monotherapy produced 10.8% weight loss over 26 weeks in phase 2 studies (2.4 mg dose)
  • CagriSema combination (cagrilintide + GLP1) achieved 20.4% weight loss at 68 weeks in phase 3 REDEFINE trials
  • Combination approaches consistently outperformed single-agent therapies across multiple dose ranges

Studies demonstrated that 100% of participants receiving GLP3 8 mg or higher achieved at least 5% weight loss, with 75-83% achieving 15% or greater weight reduction[9].

Body Composition and Metabolic Parameters

Research on component peptides revealed favorable effects on body composition and metabolic markers[10]:

  • Significant reductions in waist circumference (10-15 cm reductions observed)
  • Preferential visceral fat loss documented through imaging studies
  • Preserved lean body mass relative to total weight loss in most studies
  • Improved body composition ratios with fat mass reductions exceeding total weight loss percentages

Type 2 Diabetes Research

Glycemic Control Studies

Investigations in type 2 diabetes models demonstrated robust glucose-lowering effects[11]:

  • HbA1c reductions of 2.0-2.4% observed with GLP3 in phase 2 diabetes trials
  • Fasting plasma glucose reductions of 40-60 mg/dL documented across dose ranges
  • Improved continuous glucose monitoring parameters including time in range and glucose variability
  • CagriSema combination achieved superior glycemic control compared to individual components

Studies showed that 72% of participants with prediabetes reverted to normoglycemia with GLP3 treatment, suggesting potential diabetes prevention applications[12].

Insulin Sensitivity and Beta Cell Function

Research revealed improvements in both insulin sensitivity and pancreatic function[13]:

  • Enhanced HOMA-IR scores indicating improved insulin sensitivity
  • Reduced fasting insulin levels despite improved glucose control
  • Preserved or improved beta cell function markers (HOMA-beta, C-peptide)
  • Potential protective effects on pancreatic beta cell mass in preclinical models

Cardiovascular and Metabolic Health Research

Lipid Profile Improvements

Studies documented favorable effects on multiple cardiovascular risk markers[14]:

  • LDL cholesterol reductions of 15-20% observed with GLP3
  • Triglyceride reductions of 20-30% documented across studies
  • Improved HDL cholesterol levels in some study populations
  • Potential PCSK9 degradation effects through glucagon receptor activation

Blood Pressure and Heart Rate Effects

Cardiovascular monitoring in clinical trials revealed consistent patterns[15]:

  • Systolic blood pressure reductions of 5-10 mmHg observed with weight loss
  • Diastolic pressure improvements of 3-5 mmHg documented
  • Dose-dependent heart rate increases (5-10 bpm) that peaked at 24 weeks then declined
  • Heart rate changes similar to other GLP-1 receptor agonists

Hepatic Steatosis and Liver Health Research

Liver Fat Reduction Studies

Research in metabolic dysfunction-associated steatotic liver disease (MASLD) models showed remarkable effects[16]:

  • GLP3 achieved 82% relative liver fat reduction after 48 weeks in phase 2a MASLD trials
  • Over 85% of participants achieved resolution of MASLD (liver fat below 5%)
  • Improvements in liver enzymes (ALT, AST) and fibrosis biomarkers documented
  • Potential anti-fibrotic effects through multiple pathway modulation

The glucagon receptor component appears particularly relevant for liver fat reduction, as the liver is rich in glucagon receptors but lacks GLP-1 receptors.

Appetite Regulation and Eating Behavior Research

Satiety and Food Intake Studies

Research on individual components revealed distinct but complementary appetite effects[17]:

  • Cagrilintide reduced food intake through amylin-mediated satiety pathways in rodent models
  • GLP3 decreased meal size and frequency through multiple receptor mechanisms
  • Combined approaches showed additive effects on appetite suppression
  • “Food noise” reduction reported anecdotally in human studies (reduced food preoccupation)
Critical Research Limitation: While individual components (GLP3 and cagrilintide) have extensive phase 2 and phase 3 clinical trial data, research specifically examining the combined GLP3 + Cagrilintide formulation as a blend is extremely limited. Most combination data comes from the CagriSema program (cagrilintide + GLP1, not GLP3). Human clinical trials for the specific GLP3 + cagrilintide combination are absent from peer-reviewed literature. Extrapolation from related combination studies must be interpreted cautiously.

GLP3 + Cagrilintide Blend Pharmacokinetics & Metabolism

Absorption & Distribution

GLP3 + Cagrilintide Blend pharmacokinetics reflect the combined properties of two long-acting lipidated peptides, each engineered for extended half-life and sustained bioactivity[18]. Following subcutaneous administration in clinical models:

  • Both components demonstrate prolonged absorption with peak plasma concentrations occurring 24-72 hours post-injection
  • GLP3 exhibits approximately 6-day half-life enabling once-weekly dosing
  • Cagrilintide demonstrates 120-165 hour half-life (5-7 days) suitable for weekly administration
  • Lipid conjugation of both peptides enables albumin binding and extended systemic circulation
  • Distribution patterns show systemic exposure with concentration in metabolically active tissues

The fatty diacid modifications on both peptides (C20 for GLP3 , eicosanedioic acid for cagrilintide) serve as albumin-binding moieties that dramatically extend plasma residence time compared to native peptides.

Metabolism & Elimination

The metabolic fate of both components involves proteolytic degradation and renal clearance[19]:

  • GLP3 contains DPP-4 resistant modifications (Aib2 residue) providing enzymatic stability
  • Cagrilintide incorporates proline residues reducing fibril formation and improving stability
  • Both peptides undergo gradual proteolytic cleavage to smaller peptide fragments
  • Renal elimination represents the primary excretion pathway for metabolites
  • No significant hepatic metabolism through cytochrome P450 pathways

Steady-state concentrations are achieved after 4-5 weeks of once-weekly dosing for both components, with minimal accumulation beyond expected levels based on half-life calculations.

Pharmacodynamic Effects and Duration

Despite measurable plasma clearance, pharmacodynamic effects extend well beyond plasma half-life[20]:

  • Weight loss effects continue throughout treatment with no plateau observed within 48-week study periods
  • Glycemic improvements persist between weekly doses with stable glucose control
  • Appetite suppression effects remain consistent throughout dosing intervals
  • Tissue receptor occupancy likely exceeds plasma peptide concentrations

This disconnect between pharmacokinetics and pharmacodynamics suggests prolonged receptor engagement, tissue depot effects, or persistent downstream signaling cascade activation.

Drug Interactions and Clearance

Limited data on drug interactions indicates minimal concerns for most medications[21]:

  • Delayed gastric emptying may affect absorption kinetics of oral medications (administer 1 hour before blend)
  • No significant interactions with common diabetes medications (metformin, SGLT2 inhibitors)
  • Peptide-based metabolism avoids traditional drug interaction pathways
  • Renal impairment may require dose adjustments (data limited)

GLP3 + Cagrilintide Blend Research & Administration

Common Study Populations and Models

GLP3 and cagrilintide research has been conducted across:

  • Adult humans with obesity (BMI greater than or equal to 30 kg/m squared, or greater than or equal to 27 kg/m squared with comorbidities)
  • Adults with type 2 diabetes (HbA1c 7-10.5% on metformin or other background therapy)
  • Patients with MASLD (metabolic dysfunction-associated steatotic liver disease)
  • Rodent models (diet-induced obesity mice, db/db diabetic mice, rat models)
  • Non-human primates (rhesus monkeys for pharmacology and safety studies)
  • In vitro systems (receptor binding assays, cell signaling studies)

Research Limitations & Regulatory Status

Critical Gaps in Current Evidence

Despite promising phase 2 and advancing phase 3 data on individual components, the GLP3 + Cagrilintide Blend faces substantial knowledge gaps and translational barriers.

Lack of Combination-Specific Data

The most significant limitation is the absence of published research on the specific GLP3 + cagrilintide combination:

  • No peer-reviewed studies examining GLP3 + cagrilintide blend specifically exist
  • Combination data comes from cagrilintide + GLP1, not GLP3
  • Potential interactions between GLP3 and cagrilintide remain uninvestigated
  • Optimal dose ratios for the combination completely unknown
  • Safety profile of the specific combination uncharacterized

Long-Term Safety Considerations

Critical safety questions remain unanswered even for individual components[22]:

  • Chronic use effects beyond 68 weeks inadequately studied
  • Cardiovascular safety outcomes trials (CVOT) ongoing but not yet reported
  • Cancer risk assessment requires longer-term epidemiological data
  • Reproductive safety and effects on fertility incompletely characterized
  • Pediatric safety and efficacy not established for either component

Specific concerns include dose-dependent heart rate increases, potential thyroid C-cell effects (theoretical concern with GLP-1 agonists), and gallbladder-related adverse events observed with rapid weight loss.

Mechanistic Understanding Gaps

Fundamental aspects of combination pharmacology require clarification[23]:

  • Receptor-level interactions between components unknown (synergistic, additive, or antagonistic)
  • Optimal dosing sequences and escalation protocols not scientifically established
  • Tissue-specific distribution of combined formulation requires investigation
  • Metabolic pathway interactions between incretin and amylin systems incompletely mapped
  • Whether combination provides true synergy or simply additive effects remains unclear

Population-Specific Considerations

Research gaps exist for specific populations[24]:

  • Renal impairment effects on peptide clearance inadequately studied
  • Hepatic dysfunction impact on safety profile unclear
  • Elderly populations (over 75 years) underrepresented in trials
  • Racial and ethnic diversity in study populations limited
  • Patients with cardiovascular disease require additional safety data

Regulatory & Competitive Sport Status

FDA Position

Neither component has received FDA approval for any indication as of September 2025:

  • GLP3 in phase 3 development for obesity and type 2 diabetes (TRIUMPH trials ongoing)
  • Cagrilintide in phase 3 development as part of CagriSema combination
  • Combined GLP3 + cagrilintide formulation not under regulatory review
  • Not legally available for medical use, compounding, or human consumption
  • No established therapeutic use basis for the combination

Both peptides remain investigational drugs under active clinical development by their respective manufacturers.

WADA Prohibition

The World Anti-Doping Agency classification for these peptides:

  • GLP3 likely classified under prohibited substances as a GLP-1 receptor agonist
  • Cagrilintide status as amylin analog may fall under peptide hormone prohibitions
  • Combined formulation would be prohibited under multiple substance categories
  • No Therapeutic Use Exemptions (TUEs) available for either component
  • Detection methods under development for anti-doping testing

WADA’s position reflects that these remain investigational agents without regulatory approval from health authorities worldwide.

Research Classification: GLP3 + Cagrilintide Blend is available only for laboratory research use. It is not intended for human consumption, medical use, or veterinary applications. All research must be conducted under appropriate ethical oversight and regulatory compliance with institutional review board approval where applicable. The combination lacks specific safety and efficacy data and should be investigated with appropriate caution in controlled research settings.

Lead Researcher Spotlight

Professor Ania M. Jastreboff, MD, PhD

Director, Weight Management & Obesity Prevention

Yale School of Medicine, New Haven, Connecticut

Professor Ania Jastreboff has been a principal investigator for pivotal GLP3 clinical trials, including the landmark phase 2 obesity study published in the New England Journal of Medicine. Her research has been instrumental in establishing the clinical profile of next-generation metabolic therapies and advancing understanding of multi-receptor agonist approaches to obesity treatment.

Professor Jastreboff’s research contributions include:

  • Principal investigator for GLP3 phase 2 obesity trial demonstrating 24.2% weight loss
  • Leadership in clinical research examining triple hormone receptor agonists
  • Extensive investigations of incretin-based therapies for obesity and metabolic disease
  • Pioneering work on combination approaches to weight management
  • Studies examining neurobiological mechanisms underlying obesity pharmacotherapy

Her work has helped establish GLP3 as one of the most promising next-generation obesity treatments in clinical development, contributing to the scientific foundation for multi-pathway metabolic interventions.

Disclaimer: This spotlight is provided for educational purposes to acknowledge scientific contributions to metabolic peptide research relevant to the components of this blend. Cenexa Labs has no affiliation with Professor Jastreboff or Yale School of Medicine, and this information does not constitute an endorsement of any products or services.

References

  1. Coskun, T., Urva, S., Roell, W.C., Qu, H., Loghin, C., Kirchner, T., et al. (2022). LY3437943, a novel triple glucagon, GIP, and GLP-1 receptor agonist for glycemic control and weight loss: From discovery to clinical proof of concept. Cell Metabolism, 34(9), 1234-1247. PubMed
  2. Jastreboff, A.M., Kaplan, L.M., Frías, J.P., Wu, Q., Du, Y., Gurbuz, S., et al. (2023). Triple-hormone-receptor agonist GLP3 for obesity—A phase 2 trial. New England Journal of Medicine, 389(6), 514-526. PubMed
  3. Kruse, T., Wendelboe, P., Kragelund, R.P., Pettersson, I., Kaae, S., Hansen, J.B., et al. (2021). Development of cagrilintide, a long-acting amylin analogue. Journal of Medicinal Chemistry, 64(15), 11183-11194. PubMed
  4. Mathiesen, D.S., Lund, A., Vilsbøll, T., Knop, F.K., & Bagger, J.I. (2024). Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3. Obesity, 32(8), 1469-1480. PubMed
  5. Urva, S., Coskun, T., Loghin, C., Cui, X., Beebe, E., O’Farrell, L., et al. (2022). LY3437943, a novel triple GIP, GLP-1, and glucagon receptor agonist in people with type 2 diabetes: A phase 1b, multicentre, double-blind, placebo-controlled, randomised, multiple-ascending dose trial. Lancet, 400(10366), 1869-1881. PubMed
  6. Kleinert, M., Sachs, S., Habegger, K.M., Hofmann, S.M., & Müller, T.D. (2019). Glucagon regulation of energy expenditure. International Journal of Molecular Sciences, 20(21), 5407. PubMed
  7. Rosenstock, J., Frias, J., Jastreboff, A.M., Du, Y., Lou, J., Gurbuz, S., et al. (2023). GLP3, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes: A randomised, double-blind, placebo and active-controlled, parallel-group, phase 2 trial conducted in the USA. Lancet, 402(10401), 529-544. PubMed
  8. Wadden, T.A., Chao, A.M., Machineni, S., Kushner, R.F., Ard, J., Srivastava, G., et al. (2023). GLP2 after intensive lifestyle intervention in adults with overweight or obesity: The SURMOUNT-3 phase 3 trial. Nature Medicine, 29(11), 2909-2918. PubMed
  9. Jastreboff, A.M., Aronne, L.J., Ahmad, N.N., Wharton, S., Connery, L., Alves, B., et al. (2022). GLP2 once weekly for the treatment of obesity. New England Journal of Medicine, 387(3), 205-216. PubMed
  10. Lau, D.C.W., Erichsen, L., Francisco, A.M., Satylganova, A., le Roux, C.W., McGowan, B., et al. (2021). Once-weekly cagrilintide for weight management in people with overweight and obesity: A multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. Lancet, 398(10317), 2160-2172. PubMed
  11. Frias, J.P., Davies, M.J., Rosenstock, J., Pérez Manghi, F.C., Fernández Landó, L., Bergman, B.K., et al. (2021). GLP2 versus GLP1 once weekly in patients with type 2 diabetes. New England Journal of Medicine, 385(6), 503-515. PubMed
  12. Wilding, J.P.H., Batterham, R.L., Calanna, S., Davies, M., Van Gaal, L.F., Lingvay, I., et al. (2021). Once-weekly GLP1 in adults with overweight or obesity. New England Journal of Medicine, 384(11), 989-1002. PubMed
  13. Thomas, M.K., Nikooienejad, A., Bray, R., Cui, X., Wilson, J., Duffin, K., et al. (2009). Dual GIP and GLP-1 receptor agonist GLP2 improves beta-cell function and insulin sensitivity in type 2 diabetes. Journal of Clinical Endocrinology and Metabolism, 106(2), 388-396. PubMed
  14. Hartman, M.L., Sanyal, A.J., Loomba, R., Wilson, J.M., Nikooienejad, A., Bray, R., et al. (2020). Effects of novel dual GIP and GLP-1 receptor agonist GLP2 on biomarkers of nonalcoholic steatohepatitis in patients with type 2 diabetes. Diabetes Care, 43(6), 1352-1355. PubMed
  15. Pfeffer, M.A., Claggett, B., Diaz, R., Dickstein, K., Gerstein, H.C., Køber, L.V., et al. (2015).  in patients with type 2 diabetes and acute coronary syndrome. New England Journal of Medicine, 373(23), 2247-2257. PubMed
  16. Sanyal, A.J., Kaplan, L.M., Frias, J.P., Ikonomovic, T., Machineni, S., Gantz, I., et al. (2024). Triple hormone receptor agonist GLP3 for metabolic dysfunction-associated steatotic liver disease: A randomized phase 2a trial. Nature Medicine, 30(6), 1639-1647. PubMed
  17. Fletcher, M.M., Halls, M.L., Christopoulos, A., Sexton, P.M., & Wootten, D. (2021). AM833 is a novel agonist of calcitonin family G protein-coupled receptors: Pharmacological comparison with six selective and nonselective agonists. Journal of Pharmacology and Experimental Therapeutics, 377(3), 417-440. PubMed
  18. Aroda, V.R., Rosenstock, J., Terauchi, Y., Altuntas, Y., Lalic, N.M., Morales Villegas, E.C., et al. (2019). PIONEER 1: Randomized clinical trial of the efficacy and safety of oral GLP1 monotherapy in comparison with placebo in patients with type 2 diabetes. Diabetes Care, 42(9), 1724-1732. PubMed
  19. Nauck, M.A., Quast, D.R., Wefers, J., & Meier, J.J. (2021). GLP-1 receptor agonists in the treatment of type 2 diabetes – state-of-the-art. Molecular Metabolism, 46, 101102. PubMed
  20. Holst, J.J., & Rosenkilde, M.M. (2020). GIP as a therapeutic target in diabetes and obesity: Insight from incretin co-agonists. Journal of Clinical Endocrinology and Metabolism, 105(8), e2710-e2716. PubMed
  21. Blonde, L., Umpierrez, G.E., Reddy, S.S., McGill, J.B., Berga, S.L., Bush, M., et al. (2023). American Association of Clinical Endocrinology Clinical Practice Guideline: Developing a diabetes mellitus comprehensive care plan—2022 update. Endocrine Practice, 28(10), 923-1049. PubMed
  22. Marso, S.P., Bain, S.C., Consoli, A., Eliaschewitz, F.G., Jódar, E., Leiter, L.A., et al. (2016). GLP1 and cardiovascular outcomes in patients with type 2 diabetes. New England Journal of Medicine, 375(19), 1834-1844. PubMed
  23. Müller, T.D., Finan, B., Bloom, S.R., D’Alessio, D., Drucker, D.J., Flatt, P.R., et al. (2019). Glucagon-like peptide 1 (GLP-1). Molecular Metabolism, 30, 72-130. PubMed
  24. Garvey, W.T., Batterham, R.L., Bhatta, M., Buscemi, S., Christensen, L.N., Frias, J.P., et al. (2022). Two-year effects of GLP1 in adults with overweight or obesity: The STEP 5 trial. Nature Medicine, 28(10), 2083-2091. PubMed
  25. Aminian, A., Zajichek, A., Arterburn, D.E., Wolski, K.E., Brethauer, S.A., Schauer, P.R., et al. (2019). Association of metabolic surgery with major adverse cardiovascular outcomes in patients with type 2 diabetes and obesity. JAMA, 322(13), 1271-1282. PubMed
  26. Knudsen, L.B., & Lau, J. (2019). The discovery and development of lg and GLP1. Frontiers in Endocrinology, 10, 155. PubMed
  27. Horne, C., Supramaniam, A., Lamont, B., Parkinson, J., Park, J.E., Vath, J., et al. (2023). Efficacy and safety of co-administered once-weekly cagrilintide 2.4 mg with once-weekly GLP1 2.4 mg in type 2 diabetes: A multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet, 402(10403), 720-730. PubMed
  28. Wang, Y., Feng, Z., & Yu, L. (2025). The next frontier in metabolic health: Cagrilintide-GLP1 and the evolving landscape of therapies. The Innovation Medicine, 3(1), 100150. CrossRef

All references open in new window. These citations are provided for educational and research purposes only. This information is not intended to diagnose, treat, cure, or prevent any disease. GLP3+ Cagrilintide Blend is intended for laboratory research use only.

The Cenexa Labs Gold Standard

Most peptide sites simply resell vials from overseas labs with little oversight or testing (Much of it is either fake or laced with contaminants). At Cenexa Labs, we manufacture our own peptides under strict USA-based standards…right here IN THE USA. From synthesis to lyophilization to final vial, every step is handled under our direct control — so you never have to question what you’re getting.

We might not be the cheapest, but you can count on our peptides being 100% legit and free from contaminants, heavy metals and toxins.

Why Researchers Choose Cenexa Labs

  • End-to-End Chain of Custody: Every batch is logged, tested, and traceable — no middlemen, no relabeling, no guesswork.
  • Lot-Linked COAs: Each vial’s lot number ties directly to third-party HPLC/MS results. No recycled or generic COAs.
  • We’re the Manufacturer: Because we produce in-house, we control purity, potency, and compliance — instead of reselling from anonymous overseas labs.
  • Verified Purity, Every Time: 99%+ purity confirmed on every batch by independent labs, not just claimed on a label.
  • GMP-Aligned, USA Based: Manufactured domestically in controlled GMP, ISO 9001-audited facilities.
  • Fast, Reliable Fulfillment: Orders placed by 2pm CST ship the same business day. Free USPS Priority on orders $300+. $9.95 Flat rate shipping on all other orders with 2-3 day delivery.
  • Backed by Trust: Over 18,000 researchers nationwide rely on Cenexa Labs for consistent, verifiable peptides.
  • Room Temperature (Unmixed): Lyophilized (powder) peptides are stable for 3–4 months at room temperature if kept sealed and away from direct light.
  • Freezer (Unmixed): For long-term storage, place vials in a freezer. Depending on temperature, peptides can remain stable for 1–3 years.
  • After Reconstitution: Once mixed with bacteriostatic water, peptides must be stored in the refrigerator and remain stable for up to 30 days.

All Cenexa peptides are manufactured 100% end-to-end here in the USA using the Lyophilization (Freeze Drying) process. This ensures maximum stability and quality.

Best Practice:
Only reconstitute your peptides when you’re ready to begin using them. Until then, keep vials in their lyophilized powder form, stored in the freezer and away from light.

Fast Processing: We strive to ship same-day. During high-volume times it may take 2–3 days for your package to enter the mailstream. (You’ll see a notice at checkout and can upgrade if you need guaranteed same-day shipping.)

  • Flat Rate Shipping: $9.95 on all orders (USPS Priority Mail 2–3 days).
  • Free Shipping: Orders over $300 ship free.
  • Expedited Options: Faster methods available at checkout.

Important: Orders paid by eCheck won’t ship until payment clears our bank (usually 2–3 business days after it leaves your account).

All products are carefully packaged for safe arrival.

Need help with your order or delivery?

See What Some Of Our 18,000+ Happy Customers Have To Say…

Scroll to Top
0