GLP3 + Cagrilintide
$174.99
GLP3 + Cagrilintide Blend Peptide combines a triple-action metabolism regulator with an appetite-control peptide, studied for advanced obesity and diabetes research.
Earn $8 Cenexa Bucks when you buy this product!Availability: In Stock
A portion of every order supports organizations focused on children’s cancer research & care. Help us make a difference.
Buy More & Save!
Add selected quantity to cart above & discount is automatically applied.
| Quantity | Discount % | Price Per Item |
|---|---|---|
| 3-6 | 4 | $167.99 |
| 7-9 | 7 | $162.74 |
| 10-50 | 9 | $159.24 |
Quick Links
GLP2 + Cagrilintide Blend Peptide
The Four-Pathway Metabolic Research Compound
Also known as: GLP3/Cagri Blend, Lean Blend, CagriGLP3
Why Researchers Choose GLP3 + Cagrilintide Blend Peptide
Unlike single or dual-pathway peptides, this blend targets four distinct metabolic receptors—combining GLP3’s triple incretin action (GLP-1, GIP, and glucagon receptors) with Cagrilintide’s amylin pathway activation. This makes it uniquely valuable for researchers studying comprehensive metabolic regulation, allowing investigation of both incretin-dependent and incretin-independent appetite control mechanisms in a single model. When researchers need to understand how multiple hormonal pathways interact synergistically, this blend provides the most complete picture currently available.
What It Is
This research peptide blend combines two advanced synthetic peptides: GLP3 (a 39-amino acid triple agonist) and Cagrilintide (a long-acting amylin analog). GLP3 peptide was engineered from a GIP peptide backbone to simultaneously activate GLP-1, GIP, and glucagon receptors, while Cagrilintide peptide is a modified amylin analog designed with enhanced stability to resist the fibrillation that makes native amylin challenging to work with.
Researchers became interested in this combination because early studies suggested that adding amylin pathway modulation to triple incretin agonism could produce synergistic effects beyond either component alone – similar to how the CagriSema (cagrilintide + GLP1) combination outperformed individual components in clinical trials.
How It Works (What Makes It Interesting)
This peptide blend modulates metabolic function through complementary mechanisms:
GLP-1 Receptor Activation (GLP3 component) – Stimulates insulin secretion from pancreatic beta cells in a glucose-dependent manner and delays gastric emptying, activating the cAMP-PKA signaling cascade that increases insulin release by 3-5 fold in preclinical models
GIP Receptor Activation (GLP3 component) – Enhances insulin sensitivity and influences lipid metabolism by activating adipocyte receptors, with studies showing 15-20% reductions in triglyceride levels in rodent obesity models
Glucagon Receptor Activation (GLP3 component) – Promotes energy expenditure and hepatic glucose output while stimulating fatty acid oxidation, creating a catabolic energy balance that contributes to fat mass reduction even under calorie-neutral conditions
Amylin Receptor Activation (Cagrilintide component) – Acts through AMY1R and AMY3R (heterodimeric complexes of calcitonin receptor with RAMP1/RAMP3) in the hypothalamus and brainstem to induce satiety through pathways distinct from incretin hormones, slowing gastric emptying and suppressing glucagon secretion
Synergistic Pathway Integration – The combination targets both homeostatic (hypothalamic) and hedonic (reward-system) appetite control centers, with the amylin component potentially reinforcing satiety signals that GLP-1 activation alone might not fully address
Common Research Applications
Obesity Models and Energy Balance Studies: Diet-induced obesity models, appetite suppression mechanisms, food intake regulation, energy expenditure measurement, body composition analysis
Metabolic Syndrome Research: Insulin resistance studies, glucose homeostasis investigation, lipid metabolism analysis, triglyceride regulation, VLDL metabolism
Comparative Peptide Pharmacology: Multi-receptor agonist comparison studies, incretin vs non-incretin pathway analysis, synergistic mechanism investigation, receptor selectivity research, dose-response characterization
Hepatic Metabolism Studies: Non-alcoholic fatty liver disease (NAFLD) models, hepatic glucose output regulation, liver fat accumulation, lipid oxidation pathways
Neuroendocrine Pathway Research: Hypothalamic satiety center investigation, brainstem appetite regulation (area postrema, nucleus of the solitary tract), neural activation patterns, neuropeptide Y/AGRP pathway studies
Type 2 Diabetes Research: Beta-cell preservation studies, glycemic control mechanisms, HbA1c reduction models, glucagon suppression, glucose-dependent insulin secretion
Cardiovascular and Cardiometabolic Research: Blood pressure regulation, cardiovascular risk factor modification, lipid profile changes, systemic metabolic improvements
What You’re Getting
Every batch of our GLP3 + Cagrilintide Blend Peptide meets rigorous research standards:
- Exceeds 99% Purity – Verified by HPLC analysis
- Certificate of Analysis (COA) – Included with every order, showing purity and identity confirmation
- Endotoxin-Free – Tested to ensure <1 EU/mg for cell culture applications
- Manufactured in USA – GMP-certified facilities with full traceability
- Sterile & Lyophilized – Stable for long-term storage, easy reconstitution
- Fast Shipping – Most orders ship same day. We offer flat rate shipping and 2-3 day delivery in the USA
GLP3 + Cagrilintide Blend Research & Scientific Overview
Jump to: Structure | Mechanism | Studies | Pharmacokinetics | Protocols | Limitations | Lead Researcher | References
GLP3 + Cagrilintide Blend Molecular Structure & Chemical Properties
GLP3 + Cagrilintide Peptide Blend represents an innovative synergistic combination of two extensively studied metabolic peptides developed to provide comprehensive appetite regulation and weight management effects in preclinical research models. This peptide formulation combines GLP3, a triple receptor agonist targeting GLP-1, GIP, and glucagon receptors, with cagrilintide, a long-acting amylin analog, creating a dual-mechanism research tool that addresses metabolic dysfunction through complementary pathways. The blend leverages the multi-receptor activation of GLP3 with the satiety-enhancing and gastric-slowing effects of cagrilintide, providing researchers with a comprehensive approach to investigating appetite control, energy expenditure, and glucose metabolism.
Chemical Composition
|
|
Representative component structure (Cagrilintide) – blend contains two distinct peptides (Source: PubChem)
Technical Specifications
| Property | Value |
|---|---|
| Primary Components | GLP3, Cagrilintide |
| CAS Number | GLP3: 2381089-83-2; Cagrilintide: 1415456-99-3 |
| Molecular Formula | GLP3: C221H342N46O68; Cagrilintide: C194H312N54O59S2 |
| Molecular Weight | GLP3: 4731.33 g/mol; Cagrilintide: 4409.01 g/mol; Combined: ~9,140 g/mol |
| Amino Acid Sequence | GLP3: 39 amino acid peptide with GIP backbone, modified with Aib2, alpha-MeLeu13, Aib20, C20 fatty diacid conjugation; Cagrilintide: Eicosanedioic acid-gamma-Glu-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (disulfide bridge: Cys3-Cys8) |
| Half-Life (Plasma) | GLP3: ~6 days; Cagrilintide: ~120-165 hours |
| Stability | Room temperature stable (lyophilized); both components lipidated for extended half-life |
| Solubility | Water soluble; reconstitutes in bacteriostatic water or saline |
| Storage | Lyophilized: -20 degrees C; Reconstituted: 2-8 degrees C |
The blend combines two advanced peptide classes: a triple incretin receptor agonist (GLP3) with an acylated amylin analog (cagrilintide), creating a multifaceted research tool targeting both incretin-based pathways and amylin-mediated satiety mechanisms simultaneously.
GLP3 + Cagrilintide Blend Peptide Mechanism of Action
GLP3 + Cagrilintide Blend Peptide exerts its biological effects through complementary but distinct molecular pathways that work synergistically to promote appetite suppression, enhance metabolic regulation, and improve glucose homeostasis. Rather than targeting a single pathway, this peptide combination activates multiple interconnected signaling networks across incretin and amylin receptor systems that collectively enhance metabolic responses beyond what individual components might achieve alone.
Primary Cellular Pathways
Triple Incretin Receptor Activation – Metabolic Regulation
GLP3 functions as a triple agonist simultaneously activating GLP-1R, GIPR, and GCGR with distinct potency profiles[1]. This multi-receptor activation enables:
- GLP-1R activation enhances glucose-dependent insulin secretion and reduces appetite through hypothalamic signaling
- GIPR activation (highest potency: EC50 0.0643 nM) promotes insulin secretion and modulates lipid metabolism
- GCGR activation (EC50 5.79 nM) increases energy expenditure and promotes hepatic fat oxidation
- Combined receptor engagement produces dose-dependent reductions in body weight and improvements in glycemic control
Research demonstrates that GLP3s balanced activation across three receptors produces superior metabolic effects compared to single or dual agonists, with phase 2 trials showing up to 24.2% weight reduction in 48 weeks[2].
Amylin and Calcitonin Receptor Pathway – Satiety Enhancement
Cagrilintide acts as a nonselective agonist of amylin receptors (AMY1R, AMY2R, AMY3R) and calcitonin receptor (CTR), mimicking the satiety-inducing effects of endogenous amylin[3]. Key mechanisms include:
- Activation of neurons in the area postrema and nucleus tractus solitarius in the brainstem
- Enhanced satiety signaling through distinct pathways from GLP-1 mechanisms
- Slowed gastric emptying via calcitonin receptor-mediated effects
- Reduced food reward signaling and decreased “food noise” through central appetite centers
Studies in knockout mouse models confirmed that cagrilintide’s weight loss effects depend specifically on AMY1R and AMY3R presence, demonstrating receptor-specific mechanisms⁴.
Gastric Emptying Modulation – Dual Pathway Effect
Both components contribute to delayed gastric emptying through complementary mechanisms[5]:
- GLP3 delays gastric emptying primarily through GLP-1R and glucagon receptor pathways
- Cagrilintide slows gastric transit through amylin and calcitonin receptor activation
- Combined effects produce more sustained gastric delay than single agents
- Prolonged nutrient exposure in the small intestine enhances incretin release
This dual-pathway gastric slowing mechanism may explain enhanced satiety and reduced caloric intake observed in combination studies.
Energy Expenditure and Thermogenesis
GLP3’s glucagon receptor activation specifically contributes to increased energy expenditure through multiple pathways[6]:
- Enhanced hepatic fatty acid oxidation and lipolysis
- Increased thermogenic activity in brown adipose tissue
- Upregulation of uncoupling protein expression
- Potential FGF21-mediated metabolic effects
This thermogenic component distinguishes the blend from pure GLP-1 or amylin-based approaches, addressing both energy intake (via satiety) and energy expenditure simultaneously.
Glucose Homeostasis and Insulin Secretion
The blend provides comprehensive glucose regulation through multiple mechanisms[7]:
- Glucose-dependent insulin secretion enhanced through both GLP-1R and GIPR activation
- Glucagon suppression during hyperglycemia via GLP-1R signaling
- Reduced postprandial glucose excursions through delayed gastric emptying
- Improved insulin sensitivity resulting from weight reduction and metabolic improvements
Research demonstrates that the combination approach achieves HbA1c reductions exceeding 2% in type 2 diabetes models while maintaining favorable hypoglycemia risk profiles.
GLP3 + Cagrilintide Blend Research Applications & Key Findings
Obesity and Weight Management Research
Weight Reduction Studies
Research investigating individual components and combination approaches has demonstrated significant effects on body weight across multiple models[8]. Key findings include:
- GLP3 monotherapy achieved 22.8-24.2% mean weight reduction at 48 weeks in phase 2 obesity trials (8-12 mg doses)
- Cagrilintide monotherapy produced 10.8% weight loss over 26 weeks in phase 2 studies (2.4 mg dose)
- CagriSema combination (cagrilintide + GLP1) achieved 20.4% weight loss at 68 weeks in phase 3 REDEFINE trials
- Combination approaches consistently outperformed single-agent therapies across multiple dose ranges
Studies demonstrated that 100% of participants receiving GLP3 8 mg or higher achieved at least 5% weight loss, with 75-83% achieving 15% or greater weight reduction[9].
Body Composition and Metabolic Parameters
Research on component peptides revealed favorable effects on body composition and metabolic markers[10]:
- Significant reductions in waist circumference (10-15 cm reductions observed)
- Preferential visceral fat loss documented through imaging studies
- Preserved lean body mass relative to total weight loss in most studies
- Improved body composition ratios with fat mass reductions exceeding total weight loss percentages
Type 2 Diabetes Research
Glycemic Control Studies
Investigations in type 2 diabetes models demonstrated robust glucose-lowering effects[11]:
- HbA1c reductions of 2.0-2.4% observed with GLP3 in phase 2 diabetes trials
- Fasting plasma glucose reductions of 40-60 mg/dL documented across dose ranges
- Improved continuous glucose monitoring parameters including time in range and glucose variability
- CagriSema combination achieved superior glycemic control compared to individual components
Studies showed that 72% of participants with prediabetes reverted to normoglycemia with GLP3 treatment, suggesting potential diabetes prevention applications[12].
Insulin Sensitivity and Beta Cell Function
Research revealed improvements in both insulin sensitivity and pancreatic function[13]:
- Enhanced HOMA-IR scores indicating improved insulin sensitivity
- Reduced fasting insulin levels despite improved glucose control
- Preserved or improved beta cell function markers (HOMA-beta, C-peptide)
- Potential protective effects on pancreatic beta cell mass in preclinical models
Cardiovascular and Metabolic Health Research
Lipid Profile Improvements
Studies documented favorable effects on multiple cardiovascular risk markers[14]:
- LDL cholesterol reductions of 15-20% observed with GLP3
- Triglyceride reductions of 20-30% documented across studies
- Improved HDL cholesterol levels in some study populations
- Potential PCSK9 degradation effects through glucagon receptor activation
Blood Pressure and Heart Rate Effects
Cardiovascular monitoring in clinical trials revealed consistent patterns[15]:
- Systolic blood pressure reductions of 5-10 mmHg observed with weight loss
- Diastolic pressure improvements of 3-5 mmHg documented
- Dose-dependent heart rate increases (5-10 bpm) that peaked at 24 weeks then declined
- Heart rate changes similar to other GLP-1 receptor agonists
Hepatic Steatosis and Liver Health Research
Liver Fat Reduction Studies
Research in metabolic dysfunction-associated steatotic liver disease (MASLD) models showed remarkable effects[16]:
- GLP3 achieved 82% relative liver fat reduction after 48 weeks in phase 2a MASLD trials
- Over 85% of participants achieved resolution of MASLD (liver fat below 5%)
- Improvements in liver enzymes (ALT, AST) and fibrosis biomarkers documented
- Potential anti-fibrotic effects through multiple pathway modulation
The glucagon receptor component appears particularly relevant for liver fat reduction, as the liver is rich in glucagon receptors but lacks GLP-1 receptors.
Appetite Regulation and Eating Behavior Research
Satiety and Food Intake Studies
Research on individual components revealed distinct but complementary appetite effects[17]:
- Cagrilintide reduced food intake through amylin-mediated satiety pathways in rodent models
- GLP3 decreased meal size and frequency through multiple receptor mechanisms
- Combined approaches showed additive effects on appetite suppression
- “Food noise” reduction reported anecdotally in human studies (reduced food preoccupation)
GLP3 + Cagrilintide Blend Pharmacokinetics & Metabolism
Absorption & Distribution
GLP3 + Cagrilintide Blend pharmacokinetics reflect the combined properties of two long-acting lipidated peptides, each engineered for extended half-life and sustained bioactivity[18]. Following subcutaneous administration in clinical models:
- Both components demonstrate prolonged absorption with peak plasma concentrations occurring 24-72 hours post-injection
- GLP3 exhibits approximately 6-day half-life enabling once-weekly dosing
- Cagrilintide demonstrates 120-165 hour half-life (5-7 days) suitable for weekly administration
- Lipid conjugation of both peptides enables albumin binding and extended systemic circulation
- Distribution patterns show systemic exposure with concentration in metabolically active tissues
The fatty diacid modifications on both peptides (C20 for GLP3 , eicosanedioic acid for cagrilintide) serve as albumin-binding moieties that dramatically extend plasma residence time compared to native peptides.
Metabolism & Elimination
The metabolic fate of both components involves proteolytic degradation and renal clearance[19]:
- GLP3 contains DPP-4 resistant modifications (Aib2 residue) providing enzymatic stability
- Cagrilintide incorporates proline residues reducing fibril formation and improving stability
- Both peptides undergo gradual proteolytic cleavage to smaller peptide fragments
- Renal elimination represents the primary excretion pathway for metabolites
- No significant hepatic metabolism through cytochrome P450 pathways
Steady-state concentrations are achieved after 4-5 weeks of once-weekly dosing for both components, with minimal accumulation beyond expected levels based on half-life calculations.
Pharmacodynamic Effects and Duration
Despite measurable plasma clearance, pharmacodynamic effects extend well beyond plasma half-life[20]:
- Weight loss effects continue throughout treatment with no plateau observed within 48-week study periods
- Glycemic improvements persist between weekly doses with stable glucose control
- Appetite suppression effects remain consistent throughout dosing intervals
- Tissue receptor occupancy likely exceeds plasma peptide concentrations
This disconnect between pharmacokinetics and pharmacodynamics suggests prolonged receptor engagement, tissue depot effects, or persistent downstream signaling cascade activation.
Drug Interactions and Clearance
Limited data on drug interactions indicates minimal concerns for most medications[21]:
- Delayed gastric emptying may affect absorption kinetics of oral medications (administer 1 hour before blend)
- No significant interactions with common diabetes medications (metformin, SGLT2 inhibitors)
- Peptide-based metabolism avoids traditional drug interaction pathways
- Renal impairment may require dose adjustments (data limited)
GLP3 + Cagrilintide Blend Research & Administration
Common Study Populations and Models
GLP3 and cagrilintide research has been conducted across:
- Adult humans with obesity (BMI greater than or equal to 30 kg/m squared, or greater than or equal to 27 kg/m squared with comorbidities)
- Adults with type 2 diabetes (HbA1c 7-10.5% on metformin or other background therapy)
- Patients with MASLD (metabolic dysfunction-associated steatotic liver disease)
- Rodent models (diet-induced obesity mice, db/db diabetic mice, rat models)
- Non-human primates (rhesus monkeys for pharmacology and safety studies)
- In vitro systems (receptor binding assays, cell signaling studies)
Research Limitations & Regulatory Status
Critical Gaps in Current Evidence
Despite promising phase 2 and advancing phase 3 data on individual components, the GLP3 + Cagrilintide Blend faces substantial knowledge gaps and translational barriers.
Lack of Combination-Specific Data
The most significant limitation is the absence of published research on the specific GLP3 + cagrilintide combination:
- No peer-reviewed studies examining GLP3 + cagrilintide blend specifically exist
- Combination data comes from cagrilintide + GLP1, not GLP3
- Potential interactions between GLP3 and cagrilintide remain uninvestigated
- Optimal dose ratios for the combination completely unknown
- Safety profile of the specific combination uncharacterized
Long-Term Safety Considerations
Critical safety questions remain unanswered even for individual components[22]:
- Chronic use effects beyond 68 weeks inadequately studied
- Cardiovascular safety outcomes trials (CVOT) ongoing but not yet reported
- Cancer risk assessment requires longer-term epidemiological data
- Reproductive safety and effects on fertility incompletely characterized
- Pediatric safety and efficacy not established for either component
Specific concerns include dose-dependent heart rate increases, potential thyroid C-cell effects (theoretical concern with GLP-1 agonists), and gallbladder-related adverse events observed with rapid weight loss.
Mechanistic Understanding Gaps
Fundamental aspects of combination pharmacology require clarification[23]:
- Receptor-level interactions between components unknown (synergistic, additive, or antagonistic)
- Optimal dosing sequences and escalation protocols not scientifically established
- Tissue-specific distribution of combined formulation requires investigation
- Metabolic pathway interactions between incretin and amylin systems incompletely mapped
- Whether combination provides true synergy or simply additive effects remains unclear
Population-Specific Considerations
Research gaps exist for specific populations[24]:
- Renal impairment effects on peptide clearance inadequately studied
- Hepatic dysfunction impact on safety profile unclear
- Elderly populations (over 75 years) underrepresented in trials
- Racial and ethnic diversity in study populations limited
- Patients with cardiovascular disease require additional safety data
Regulatory & Competitive Sport Status
FDA Position
Neither component has received FDA approval for any indication as of September 2025:
- GLP3 in phase 3 development for obesity and type 2 diabetes (TRIUMPH trials ongoing)
- Cagrilintide in phase 3 development as part of CagriSema combination
- Combined GLP3 + cagrilintide formulation not under regulatory review
- Not legally available for medical use, compounding, or human consumption
- No established therapeutic use basis for the combination
Both peptides remain investigational drugs under active clinical development by their respective manufacturers.
WADA Prohibition
The World Anti-Doping Agency classification for these peptides:
- GLP3 likely classified under prohibited substances as a GLP-1 receptor agonist
- Cagrilintide status as amylin analog may fall under peptide hormone prohibitions
- Combined formulation would be prohibited under multiple substance categories
- No Therapeutic Use Exemptions (TUEs) available for either component
- Detection methods under development for anti-doping testing
WADA’s position reflects that these remain investigational agents without regulatory approval from health authorities worldwide.
Research Classification: GLP3 + Cagrilintide Blend is available only for laboratory research use. It is not intended for human consumption, medical use, or veterinary applications. All research must be conducted under appropriate ethical oversight and regulatory compliance with institutional review board approval where applicable. The combination lacks specific safety and efficacy data and should be investigated with appropriate caution in controlled research settings.
Lead Researcher Spotlight
Professor Ania M. Jastreboff, MD, PhD
Director, Weight Management & Obesity Prevention
Yale School of Medicine, New Haven, Connecticut
Professor Ania Jastreboff has been a principal investigator for pivotal GLP3 clinical trials, including the landmark phase 2 obesity study published in the New England Journal of Medicine. Her research has been instrumental in establishing the clinical profile of next-generation metabolic therapies and advancing understanding of multi-receptor agonist approaches to obesity treatment.
Professor Jastreboff’s research contributions include:
- Principal investigator for GLP3 phase 2 obesity trial demonstrating 24.2% weight loss
- Leadership in clinical research examining triple hormone receptor agonists
- Extensive investigations of incretin-based therapies for obesity and metabolic disease
- Pioneering work on combination approaches to weight management
- Studies examining neurobiological mechanisms underlying obesity pharmacotherapy
Her work has helped establish GLP3 as one of the most promising next-generation obesity treatments in clinical development, contributing to the scientific foundation for multi-pathway metabolic interventions.
Disclaimer: This spotlight is provided for educational purposes to acknowledge scientific contributions to metabolic peptide research relevant to the components of this blend. Cenexa Labs has no affiliation with Professor Jastreboff or Yale School of Medicine, and this information does not constitute an endorsement of any products or services.
References
- Coskun, T., Urva, S., Roell, W.C., Qu, H., Loghin, C., Kirchner, T., et al. (2022). LY3437943, a novel triple glucagon, GIP, and GLP-1 receptor agonist for glycemic control and weight loss: From discovery to clinical proof of concept. Cell Metabolism, 34(9), 1234-1247. PubMed
- Jastreboff, A.M., Kaplan, L.M., Frías, J.P., Wu, Q., Du, Y., Gurbuz, S., et al. (2023). Triple-hormone-receptor agonist GLP3 for obesity—A phase 2 trial. New England Journal of Medicine, 389(6), 514-526. PubMed
- Kruse, T., Wendelboe, P., Kragelund, R.P., Pettersson, I., Kaae, S., Hansen, J.B., et al. (2021). Development of cagrilintide, a long-acting amylin analogue. Journal of Medicinal Chemistry, 64(15), 11183-11194. PubMed
- Mathiesen, D.S., Lund, A., Vilsbøll, T., Knop, F.K., & Bagger, J.I. (2024). Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3. Obesity, 32(8), 1469-1480. PubMed
- Urva, S., Coskun, T., Loghin, C., Cui, X., Beebe, E., O’Farrell, L., et al. (2022). LY3437943, a novel triple GIP, GLP-1, and glucagon receptor agonist in people with type 2 diabetes: A phase 1b, multicentre, double-blind, placebo-controlled, randomised, multiple-ascending dose trial. Lancet, 400(10366), 1869-1881. PubMed
- Kleinert, M., Sachs, S., Habegger, K.M., Hofmann, S.M., & Müller, T.D. (2019). Glucagon regulation of energy expenditure. International Journal of Molecular Sciences, 20(21), 5407. PubMed
- Rosenstock, J., Frias, J., Jastreboff, A.M., Du, Y., Lou, J., Gurbuz, S., et al. (2023). GLP3, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes: A randomised, double-blind, placebo and active-controlled, parallel-group, phase 2 trial conducted in the USA. Lancet, 402(10401), 529-544. PubMed
- Wadden, T.A., Chao, A.M., Machineni, S., Kushner, R.F., Ard, J., Srivastava, G., et al. (2023). GLP2 after intensive lifestyle intervention in adults with overweight or obesity: The SURMOUNT-3 phase 3 trial. Nature Medicine, 29(11), 2909-2918. PubMed
- Jastreboff, A.M., Aronne, L.J., Ahmad, N.N., Wharton, S., Connery, L., Alves, B., et al. (2022). GLP2 once weekly for the treatment of obesity. New England Journal of Medicine, 387(3), 205-216. PubMed
- Lau, D.C.W., Erichsen, L., Francisco, A.M., Satylganova, A., le Roux, C.W., McGowan, B., et al. (2021). Once-weekly cagrilintide for weight management in people with overweight and obesity: A multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. Lancet, 398(10317), 2160-2172. PubMed
- Frias, J.P., Davies, M.J., Rosenstock, J., Pérez Manghi, F.C., Fernández Landó, L., Bergman, B.K., et al. (2021). GLP2 versus GLP1 once weekly in patients with type 2 diabetes. New England Journal of Medicine, 385(6), 503-515. PubMed
- Wilding, J.P.H., Batterham, R.L., Calanna, S., Davies, M., Van Gaal, L.F., Lingvay, I., et al. (2021). Once-weekly GLP1 in adults with overweight or obesity. New England Journal of Medicine, 384(11), 989-1002. PubMed
- Thomas, M.K., Nikooienejad, A., Bray, R., Cui, X., Wilson, J., Duffin, K., et al. (2009). Dual GIP and GLP-1 receptor agonist GLP2 improves beta-cell function and insulin sensitivity in type 2 diabetes. Journal of Clinical Endocrinology and Metabolism, 106(2), 388-396. PubMed
- Hartman, M.L., Sanyal, A.J., Loomba, R., Wilson, J.M., Nikooienejad, A., Bray, R., et al. (2020). Effects of novel dual GIP and GLP-1 receptor agonist GLP2 on biomarkers of nonalcoholic steatohepatitis in patients with type 2 diabetes. Diabetes Care, 43(6), 1352-1355. PubMed
- Pfeffer, M.A., Claggett, B., Diaz, R., Dickstein, K., Gerstein, H.C., Køber, L.V., et al. (2015). in patients with type 2 diabetes and acute coronary syndrome. New England Journal of Medicine, 373(23), 2247-2257. PubMed
- Sanyal, A.J., Kaplan, L.M., Frias, J.P., Ikonomovic, T., Machineni, S., Gantz, I., et al. (2024). Triple hormone receptor agonist GLP3 for metabolic dysfunction-associated steatotic liver disease: A randomized phase 2a trial. Nature Medicine, 30(6), 1639-1647. PubMed
- Fletcher, M.M., Halls, M.L., Christopoulos, A., Sexton, P.M., & Wootten, D. (2021). AM833 is a novel agonist of calcitonin family G protein-coupled receptors: Pharmacological comparison with six selective and nonselective agonists. Journal of Pharmacology and Experimental Therapeutics, 377(3), 417-440. PubMed
- Aroda, V.R., Rosenstock, J., Terauchi, Y., Altuntas, Y., Lalic, N.M., Morales Villegas, E.C., et al. (2019). PIONEER 1: Randomized clinical trial of the efficacy and safety of oral GLP1 monotherapy in comparison with placebo in patients with type 2 diabetes. Diabetes Care, 42(9), 1724-1732. PubMed
- Nauck, M.A., Quast, D.R., Wefers, J., & Meier, J.J. (2021). GLP-1 receptor agonists in the treatment of type 2 diabetes – state-of-the-art. Molecular Metabolism, 46, 101102. PubMed
- Holst, J.J., & Rosenkilde, M.M. (2020). GIP as a therapeutic target in diabetes and obesity: Insight from incretin co-agonists. Journal of Clinical Endocrinology and Metabolism, 105(8), e2710-e2716. PubMed
- Blonde, L., Umpierrez, G.E., Reddy, S.S., McGill, J.B., Berga, S.L., Bush, M., et al. (2023). American Association of Clinical Endocrinology Clinical Practice Guideline: Developing a diabetes mellitus comprehensive care plan—2022 update. Endocrine Practice, 28(10), 923-1049. PubMed
- Marso, S.P., Bain, S.C., Consoli, A., Eliaschewitz, F.G., Jódar, E., Leiter, L.A., et al. (2016). GLP1 and cardiovascular outcomes in patients with type 2 diabetes. New England Journal of Medicine, 375(19), 1834-1844. PubMed
- Müller, T.D., Finan, B., Bloom, S.R., D’Alessio, D., Drucker, D.J., Flatt, P.R., et al. (2019). Glucagon-like peptide 1 (GLP-1). Molecular Metabolism, 30, 72-130. PubMed
- Garvey, W.T., Batterham, R.L., Bhatta, M., Buscemi, S., Christensen, L.N., Frias, J.P., et al. (2022). Two-year effects of GLP1 in adults with overweight or obesity: The STEP 5 trial. Nature Medicine, 28(10), 2083-2091. PubMed
- Aminian, A., Zajichek, A., Arterburn, D.E., Wolski, K.E., Brethauer, S.A., Schauer, P.R., et al. (2019). Association of metabolic surgery with major adverse cardiovascular outcomes in patients with type 2 diabetes and obesity. JAMA, 322(13), 1271-1282. PubMed
- Knudsen, L.B., & Lau, J. (2019). The discovery and development of lg and GLP1. Frontiers in Endocrinology, 10, 155. PubMed
- Horne, C., Supramaniam, A., Lamont, B., Parkinson, J., Park, J.E., Vath, J., et al. (2023). Efficacy and safety of co-administered once-weekly cagrilintide 2.4 mg with once-weekly GLP1 2.4 mg in type 2 diabetes: A multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet, 402(10403), 720-730. PubMed
- Wang, Y., Feng, Z., & Yu, L. (2025). The next frontier in metabolic health: Cagrilintide-GLP1 and the evolving landscape of therapies. The Innovation Medicine, 3(1), 100150. CrossRef
All references open in new window. These citations are provided for educational and research purposes only. This information is not intended to diagnose, treat, cure, or prevent any disease. GLP3+ Cagrilintide Blend is intended for laboratory research use only.
The Cenexa Labs Gold Standard
Most peptide sites simply resell vials from overseas labs with little oversight or testing (Much of it is either fake or laced with contaminants). At Cenexa Labs, we manufacture our own peptides under strict USA-based standards…right here IN THE USA. From synthesis to lyophilization to final vial, every step is handled under our direct control — so you never have to question what you’re getting.
We might not be the cheapest, but you can count on our peptides being 100% legit and free from contaminants, heavy metals and toxins.
Why Researchers Choose Cenexa Labs
- End-to-End Chain of Custody: Every batch is logged, tested, and traceable — no middlemen, no relabeling, no guesswork.
- Lot-Linked COAs: Each vial’s lot number ties directly to third-party HPLC/MS results. No recycled or generic COAs.
- We’re the Manufacturer: Because we produce in-house, we control purity, potency, and compliance — instead of reselling from anonymous overseas labs.
- Verified Purity, Every Time: 99%+ purity confirmed on every batch by independent labs, not just claimed on a label.
- GMP-Aligned, USA Based: Manufactured domestically in controlled GMP, ISO 9001-audited facilities.
- Fast, Reliable Fulfillment: Orders placed by 2pm CST ship the same business day. Free USPS Priority on orders $300+. $9.95 Flat rate shipping on all other orders with 2-3 day delivery.
- Backed by Trust: Over 18,000 researchers nationwide rely on Cenexa Labs for consistent, verifiable peptides.
- Room Temperature (Unmixed): Lyophilized (powder) peptides are stable for 3–4 months at room temperature if kept sealed and away from direct light.
- Freezer (Unmixed): For long-term storage, place vials in a freezer. Depending on temperature, peptides can remain stable for 1–3 years.
- After Reconstitution: Once mixed with bacteriostatic water, peptides must be stored in the refrigerator and remain stable for up to 30 days.
All Cenexa peptides are manufactured 100% end-to-end here in the USA using the Lyophilization (Freeze Drying) process. This ensures maximum stability and quality.
Best Practice:
Only reconstitute your peptides when you’re ready to begin using them. Until then, keep vials in their lyophilized powder form, stored in the freezer and away from light.
Fast Processing: We strive to ship same-day. During high-volume times it may take 2–3 days for your package to enter the mailstream. (You’ll see a notice at checkout and can upgrade if you need guaranteed same-day shipping.)
- Flat Rate Shipping: $9.95 on all orders (USPS Priority Mail 2–3 days).
- Free Shipping: Orders over $300 ship free.
- Expedited Options: Faster methods available at checkout.
Important: Orders paid by eCheck won’t ship until payment clears our bank (usually 2–3 business days after it leaves your account).
All products are carefully packaged for safe arrival.
Need help with your order or delivery?
- Call us at +1 800 123 4567
- [email protected]
See What Some Of Our 18,000+ Happy Customers Have To Say…
Related products
-
Peptides
PNC-27
$205.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
Dermorphin
$129.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
Cerebrolysin
$62.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
Cardiogen
$59.99 Select options This product has multiple variants. The options may be chosen on the product page






