Hexarelin
$29.99 – $44.99Price range: $29.99 through $44.99
Hexarelin is a synthetic peptide studied for heart protection and growth hormone release through its unique dual-receptor mechanism.
Earn $1 Cenexa Buck when you buy this product!Availability: In Stock
A portion of every order supports organizations focused on children’s cancer research & care. Help us make a difference.
Buy More & Save!
Add selected quantity to cart above & discount is automatically applied.
| Quantity | Discount % | Price Per Item |
|---|---|---|
| 3-6 | 4 | $28.79 |
| 7-9 | 7 | $27.89 |
| 10-50 | 9 | $27.29 |
| Quantity | Discount % | Price Per Item |
|---|---|---|
| 3-6 | 4 | $43.19 |
| 7-9 | 7 | $41.84 |
| 10-50 | 9 | $40.94 |
Quick Links
Hexarelin Peptide
The Dual-Receptor Cardioprotective Peptide
Also known as: Examorelin, HEX
Why Researchers Choose Hexarelin
Unlike most growth hormone secretagogues that work through a single receptor pathway, Hexarelin activates two distinct receptors—the growth hormone secretagogue receptor (GHS-R1a) and the scavenger receptor CD36. This dual-receptor activity makes it uniquely valuable for cardiovascular research, as the CD36 pathway provides direct cardiac protection independent of growth hormone effects, offering researchers a way to study heart function separately from systemic hormonal changes.
What It Is
Hexarelin peptide is a synthetic six-amino acid peptide originally developed to stimulate growth hormone release by mimicking ghrelin, the body’s natural “hunger hormone.” Researchers became particularly interested when early studies revealed something unexpected: cardioprotective effects that occurred even when growth hormone pathways were blocked. This led to the discovery that Hexarelin binds directly to CD36 receptors in heart tissue—making it one of the few peptides with documented dual-receptor activity affecting both neuroendocrine and cardiovascular systems.
How It Works (What Makes It Interesting)
Studies suggest Hexarelin may influence multiple physiological systems through distinct mechanisms:
- GHS-R1a activation – Binds to growth hormone secretagogue receptors in the pituitary and hypothalamus, triggering pulsatile growth hormone release with higher amplitude than many other GHRPs
- CD36 receptor binding – Directly activates this cardiac scavenger receptor, providing cardioprotective effects independent of growth hormone that include improved coronary perfusion and reduced ischemic damage
- PPARγ pathway modulation – Through CD36 activation, may enhance peroxisome proliferator-activated receptor gamma signaling, influencing lipid metabolism and adipocyte function
- Anti-apoptotic signaling – Research indicates potential modulation of PTEN/Akt pathways in cardiac tissue, which may help protect cardiomyocytes from programmed cell death during ischemic events
- Nitric oxide enhancement – May increase endothelial nitric oxide synthase expression, supporting vascular function and blood flow regulation
Common Research Applications
Cardiovascular Studies: Ischemia-reperfusion injury models, myocardial infarction, cardiac fibrosis, atherosclerosis, coronary perfusion dynamics
Metabolic Research: Insulin resistance models, lipid metabolism disorders, hepatic steatosis, visceral fat studies, adipocyte differentiation
Growth Hormone Physiology: GH secretion dynamics, pituitary function studies, GH-independent peripheral effects, receptor desensitization patterns
Lipid & Cholesterol Research: Oxidized LDL uptake in macrophages, HDL/LDL ratio modulation, foam cell formation, atherosclerotic plaque development
Body Composition Models: Lean mass vs fat mass distribution, lipodystrophy conditions, muscle protein synthesis, skeletal tissue adaptation
Neuroprotection Studies: Hippocampal neurogenesis, ischemic stroke models, neuroprotective signaling pathways, cognitive function in aging
What You’re Getting
Every batch of our Hexarelin peptide meets rigorous research standards:
- Exceeds 99% Purity – Verified by HPLC analysis
- Certificate of Analysis (COA) – Included with every order, showing purity and identity confirmation
- Endotoxin-Free – Tested to ensure <1 EU/mg for cell culture applications
- Manufactured in USA – GMP-certified facilities with full traceability
- Sterile & Lyophilized – Stable for long-term storage, easy reconstitution
- Fast Shipping – Most orders ship same day. We offer flat rate shipping and 2-3 day delivery in the USA
Click the “Add To Cart” button to grab your Hexarelin today!
HEXARELIN RESEARCH & SCIENTIFIC OVERVIEW
Jump to: Structure | Mechanism | Studies | Pharmacokinetics | Protocols | Limitations | Lead Researcher | References
Hexarelin Molecular Structure & Chemical Properties
Hexarelin, also known by its International Nonproprietary Name examorelin, represents one of the most potent synthetic growth hormone secretagogues in the GHRP family. Developed in the 1990s by Europeptides and Mediolanum Farmaceutici, this hexapeptide has generated substantial research interest due to its robust growth hormone-releasing properties and unique cardiovascular effects that distinguish it from other GHRPs. Unlike its predecessor GHRP-6, hexarelin exhibits greater chemical stability through the substitution of tryptophan with 2-methyl-D-tryptophan, providing enhanced resistance to enzymatic degradation and a longer duration of action. With over three decades of preclinical investigation, hexarelin has become a valuable research tool for understanding growth hormone regulation, cardiac protection mechanisms, and metabolic pathways.
Chemical Structure
|
|
2D molecular structure (Source: PubChem)
Technical Specifications
| Property | Value |
|---|---|
| CAS Number | 117628-82-7 |
| Molecular Formula | C1350H2153N405O433S39 (subscripted) |
| Molecular Weight | 3780 g/mol |
| Amino Acid Sequence | MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW |
| Half-Life (Plasma) | 90-130 minutes (rat models; native FST-315) |
| Stability | Stable in lyophilized form at -20 degrees C |
| Solubility | Water soluble; compatible with physiological saline solutions |
| Storage | Lyophilized: -20 degrees C; Reconstituted: 2-8 degrees C |
The peptide’s structure features D-amino acid substitutions at positions 2 and 5, which confer greater stability compared to naturally occurring L-amino acids. The 2-methyl group on the D-tryptophan residue at position 2 provides enhanced metabolic stability while maintaining high receptor binding affinity.
Hexarelin Mechanism of Action
Hexarelin exerts its biological effects primarily through activation of the growth hormone secretagogue receptor (GHSR-1a), a G-protein-coupled receptor originally identified in the hypothalamus and pituitary gland. However, research has revealed that hexarelin’s actions extend well beyond simple growth hormone release, involving multiple receptor systems and signaling pathways that contribute to its diverse physiological effects. This multi-receptor profile distinguishes hexarelin from other GHRPs and accounts for its unique cardiovascular and metabolic activities.
Primary Cellular Pathways
GHSR-1a Activation – Growth Hormone Release
Hexarelin binds to and activates GHSR-1a receptors located in both the hypothalamus and anterior pituitary gland, triggering a cascade that results in pulsatile growth hormone secretion. Research demonstrates that hexarelin stimulates growth hormone release more potently than growth hormone-releasing hormone (GHRH) itself in many experimental models. Key findings include:
- Dose-dependent GH release with peak plasma concentrations occurring 30 minutes post-administration in human studies
- Synergistic effects when combined with GHRH, producing massive increases in plasma growth hormone levels
- Reduced somatostatin activity, indirectly enhancing growth hormone output by suppressing the growth hormone-inhibiting hormone
- Maintained activity even in the presence of elevated circulating growth hormone levels
Studies in rat models showed that hexarelin stimulates growth hormone secretion through mechanisms involving both direct pituitary action and hypothalamic pathways, with effects that persist longer than those of GHRH alone.
CD36 Scavenger Receptor Binding – Cardioprotection
A distinctive feature of hexarelin is its ability to bind and activate the CD36 scavenger receptor, a glycoprotein expressed at high levels in cardiac tissue. This non-GHSR pathway mediates many of hexarelin’s cardiovascular effects. Research has demonstrated:
- Direct cardioprotective actions independent of growth hormone elevation
- Protection against ischemia-reperfusion injury in heart tissue through CD36 activation
- Mitochondrial biogenesis promotion in adipocytes and cardiac cells
- Fat oxidation enhancement through CD36-mediated metabolic pathways
Photoaffinity labeling studies identified CD36 as a specific cardiac receptor for hexarelin, with binding affinity distinct from GHSR-1a, suggesting the existence of tissue-specific receptor populations.
Calcium Channel and PKC Modulation
Hexarelin influences intracellular calcium signaling and activates protein kinase C (PKC) pathways in cardiac tissue. Research in isolated cardiomyocytes has shown:
- Increased amplitude of intracellular calcium transients in ventricular myocytes
- Enhanced L-type calcium current, leading to positive inotropic effects
- PKC-dependent signaling mediating coronary vasoconstriction and contractility
- Concentration and time-dependent effects on papillary muscle contraction
These calcium-related mechanisms contribute to hexarelin’s acute cardiac effects and may play roles in both its protective and functional impacts on heart tissue.
HPA Axis Stimulation
Beyond growth hormone, hexarelin peptide stimulates the hypothalamic-pituitary-adrenal (HPA) axis, resulting in increased secretion of adrenocorticotropic hormone (ACTH), cortisol, and prolactin. Studies in humans revealed:
- Significant ACTH and cortisol release with peak levels occurring 30-45 minutes post-administration
- Arginine vasopressin (AVP) pathway involvement rather than CRH-mediated mechanisms
- Prolactin elevation through direct pituitary stimulation
- No effect on luteinizing hormone, follicle-stimulating hormone, or thyroid-stimulating hormone
The HPA axis activation occurs at lower doses than required for maximal growth hormone release, suggesting high receptor sensitivity in corticotroph cells.
PTEN/Akt Signaling Pathway
Recent investigations have identified hexarelin’s ability to modulate the PTEN/Akt signaling pathway, which plays critical roles in cell survival and cardiac remodeling:
- Downregulation of PTEN expression in cardiac tissue
- Enhanced Akt phosphorylation, promoting cell survival signals
- Reduced apoptosis in cardiomyocytes under stress conditions
- Prevention of pathological cardiac remodeling in heart failure models
This mechanism represents a novel therapeutic target for cardiac protection and may explain hexarelin’s sustained protective effects beyond acute administration.
Hexarelin Research Applications & Key Findings
Cardiovascular Research
Cardiac Ischemia and Myocardial Infarction
Hexarelin has been extensively studied in animal models of cardiac injury, demonstrating remarkable cardioprotective properties. Research in mouse and rat models of myocardial infarction has shown:
- Reduced infarct size by approximately 40-50% when administered within 30 minutes of coronary artery ligation
- Improved left ventricular ejection fraction maintained at 14 and 21 days post-infarction
- Enhanced cardiac cell survival through anti-apoptotic mechanisms mediated by CD36 activation
- Decreased levels of malondialdehyde and increased superoxide dismutase activity, indicating antioxidant effects
Studies revealed that a single oral dose of hexarelin administered at the acute phase after myocardial infarction protected chronic cardiac function, with effects including lower lung weight ratios (indicating reduced pulmonary congestion) and preserved contractility.
Cardiac Remodeling and Fibrosis
Research has demonstrated hexarelin’s ability to prevent pathological cardiac remodeling following injury:
- Significant reduction in interstitial collagen deposition in heart failure models
- Decreased left ventricular mass in treated animals compared to controls
- Improved diastolic function through reduction of cardiac stiffness
- Attenuated fibrosis in spontaneously hypertensive rats with chronic administration
Immunohistochemistry studies showed reduced expression of pro-fibrotic markers including transforming growth factor-beta and collagen type I in hexarelin-treated hearts.
Autonomic Nervous System Modulation
Hexarelin treatment influences autonomic balance, with beneficial effects on heart rate variability:
- Shift toward parasympathetic activity as evidenced by heart rate variability analysis
- Reduced plasma epinephrine and dopamine levels following myocardial infarction
- Lower sympathetic drive indicated by decreased low-to-high frequency power ratios
- Improved autonomic regulation potentially contributing to reduced arrhythmia risk
Metabolic and Body Composition Research
Lipid Metabolism and Dyslipidemia
Research in insulin-resistant and diabetic animal models has revealed hexarelin’s effects on lipid metabolism:
- Reduced plasma cholesterol concentrations in hypophysectomized and obese Zucker rats
- Improved lipid profiles including decreased triglycerides in metabolic syndrome models
- Enhanced fat oxidation through CD36-mediated mitochondrial biogenesis in white adipocytes
- Correction of dyslipidemia in non-obese insulin-resistant mice with twice-daily administration
Studies using mouse models demonstrated that hexarelin treatment improved metabolic parameters independent of significant changes in body weight or food intake.
Insulin Sensitivity and Glucose Homeostasis
Investigations in diabetic models have examined hexarelin’s metabolic effects:
- No adverse effects on glucose tolerance or insulin sensitivity in most models
- Preserved glucose homeostasis during chronic treatment in healthy subjects
- Potential protective effects on pancreatic beta-cell function in some studies
- Altered calcium and potassium processing in cardiac muscle of diabetic rats
Skeletal Muscle and Cachexia Research
Muscle Wasting Prevention
Studies in chemotherapy-induced cachexia models demonstrated hexarelin’s muscle-protective properties:
- Significant protection against cisplatin-induced muscle atrophy in rats
- Preserved mitochondrial function in skeletal muscle during toxic insults
- Maintained muscle fiber cross-sectional area compared to untreated controls
- Reduced inflammatory markers in muscle tissue during catabolic stress
Research comparing hexarelin to other growth hormone secretagogues showed comparable or superior efficacy in preventing muscle mass loss.
Neuroprotection Research
Neurodegenerative Disease Models
Emerging research has explored hexarelin’s neuroprotective potential:
- Increased neurogenesis in hippocampal regions in preclinical models
- Reduced neuroinflammation through modulation of microglial activation
- Enhanced cell survival in models of amyotrophic lateral sclerosis (ALS) using mutated neuroblastoma cells
- Protection against oxidative stress in brain tissue through antioxidant mechanisms
Studies in brain injury models showed hexarelin reduced lesion volumes and improved neurobehavioral outcomes compared to vehicle-treated controls.
Hexarelin Pharmacokinetics & Metabolism
Absorption & Distribution
Hexarelin exhibits favorable pharmacokinetic properties compared to many peptides, with research demonstrating activity via multiple administration routes. Following intravenous administration in animal models:
- Rapid distribution with detectable plasma levels within 5-10 minutes
- Volume of distribution of 387.7 ml/kg in dogs and 744 ml/kg in rats at steady state
- Systemic bioavailability of approximately 64% following subcutaneous administration in rats
- Oral bioavailability demonstrated in preclinical models, though significantly lower than parenteral routes
Studies using radiolabeled hexarelin showed highest tissue concentrations in the duodenum, kidney, and liver, with significant cardiac uptake corresponding to therapeutic effects.
Distribution studies revealed specific binding in cardiovascular tissues, with highest concentrations detected in ventricles, followed by atria, aorta, and coronary vessels, consistent with high CD36 receptor expression in these tissues.
Metabolism & Elimination
The metabolic pathways of hexarelin have been partially characterized in animal models:
- Plasma half-life of 75.9 minutes in rats and approximately 120 minutes in dogs following intravenous administration
- Systemic clearance of 7.6 ml/min/kg in rats and 4.28 ml/min/kg in dogs
- Growth hormone elimination half-life of approximately 55 minutes in human studies following hexarelin-induced release
- Peptidase degradation likely occurs, though specific enzymes have not been fully characterized
Research examining intestinal degradation identified deamidation at the lysine residue as a primary metabolic pathway, with trypsin-like enzymes implicated in the breakdown process.
Hepatic extraction studies in isolated perfused rat liver demonstrated significant first-pass metabolism, partially explaining the lower oral bioavailability compared to parenteral routes.
Excretion Pathways
Limited data on excretion routes indicates:
- Renal elimination appears to be the primary route for peptide fragments
- Biliary excretion contributes to clearance based on studies in bile duct-exteriorized rats
- No accumulation observed with repeated subcutaneous dosing across a 10-fold dose range
- Dose-independent clearance suggesting non-saturable elimination pathways
The discrepancy between relatively short plasma half-life and prolonged pharmacodynamic effects (growth hormone elevation persisting 3-4 hours) suggests either active metabolites, tissue retention, or persistent receptor activation beyond plasma clearance.
Hexarelin Research Protocols & Administration
Dosing in Published Research
Research investigations have employed diverse hexarelin doses depending on species, model, and administration route:
- Rat studies: 10-500 mcg/kg typical range, with 80-150 mcg/kg most common for twice-daily administration
- Mouse models: 0.3 mg/kg/day (300 mcg/kg) standard dose for cardiovascular protection studies
- Dog studies: 1-100 mcg/kg used in pharmacokinetic and pharmacodynamic investigations
- Human studies: 0.5-2 mcg/kg intravenous bolus; 20-60 mcg/kg intranasal administration (3 times daily in pediatric growth studies)
Important: These are experimental doses used in animal and early human research studies and cannot be extrapolated to other species due to significant differences in metabolism, receptor density, pharmacokinetics, and peptide degradation rates across species. Hexarelin exhibits species-specific pharmacological profiles that profoundly influence both efficacy and safety parameters.
Administration Routes in Research
Multiple delivery methods have been investigated in preclinical and clinical studies:
- Intravenous injection – Used in acute pharmacodynamic studies in both animals and humans; produces rapid, high-amplitude growth hormone peaks
- Subcutaneous injection – Most common route in chronic animal studies; bioavailability of 64% in rats; sustained absorption profile
- Intraperitoneal injection – Frequently used in rodent research; reliable systemic delivery with rapid absorption
- Oral administration – Unusual for peptides; hexarelin demonstrates measurable oral activity though with low bioavailability (0.3% in humans based on GH response)
- Intranasal administration – Evaluated in pediatric studies; equivalent efficacy to intravenous dosing at 20-fold higher doses
- Intracerebroventricular – Used in mechanistic studies to distinguish central versus peripheral effects
Common Model Organisms
Hexarelin has been studied across multiple species and experimental systems:
- Rats – Primary research model (Sprague-Dawley, Wistar, obese Zucker strains); extensive cardiovascular and metabolic data
- Mice – C57BL/6J strain commonly used; myocardial infarction, metabolic syndrome, and genetic knockout models
- Dogs – Employed for pharmacokinetic characterization and cardiovascular assessments
- Rabbits – Historical studies in growth hormone release mechanisms
- Humans – Limited to acute pharmacodynamic studies in healthy volunteers and small pediatric growth hormone deficiency trials
- Cell culture – H9c2 cardiac myocytes, primary rat cardiomyocytes, endothelial cells, adipocytes, and neuroblastoma cell lines
Research Limitations & Regulatory Status
Critical Gaps in Current Evidence
Despite over 30 years of preclinical research, hexarelin faces substantial translational barriers that limit its research utility and prevent clinical development.
Lack of Human Clinical Data
The most significant limitation is the near-complete absence of therapeutic human trials:
- No completed Phase II or III clinical trials for any therapeutic indication in peer-reviewed literature
- Limited Phase I data restricted to acute pharmacodynamic assessments in healthy volunteers
- Pediatric growth studies initiated but never published as completed therapeutic trials
- Human safety profile incompletely characterized beyond acute single-dose studies
- Long-term human safety completely unstudied
- Optimal therapeutic dosing in humans undetermined
- Chronic desensitization observed in animal studies with repeated dosing (50-75% efficacy reduction over weeks)
This absence of clinical data represents a critical gap given the extensive preclinical evidence for cardiovascular and metabolic benefits.
Mechanistic Understanding Gaps
Fundamental aspects of hexarelin’s mechanism remain incompletely understood:
- Relative contribution of GHSR-1a versus CD36 pathways to different effects unclear
- Tissue-specific receptor populations require further characterization
- Active metabolites versus parent compound contribution to prolonged effects unknown
- Receptor desensitization mechanisms incompletely elucidated despite observed tolerance
- Species differences in receptor expression and signaling not fully mapped
The lack of GHSR-1a expression in some cell types that respond to hexarelin suggests additional unidentified receptors may exist.
Long-Term Safety Considerations
Critical safety questions remain unanswered:
- Chronic cardiovascular effects beyond 3-4 weeks unstudied even in animals
- Oncogenic potential inadequately assessed despite effects on cell proliferation pathways
- Endocrine disruption with prolonged HPA axis stimulation not evaluated long-term
- Receptor downregulation consequences with extended use unknown
- Drug interaction potential with cardiovascular medications uncharacterized
- Reproductive and developmental toxicity inadequately studied
- Rebound effects after treatment cessation not systematically evaluated
The partial desensitization observed in chronic studies raises questions about sustained therapeutic benefit.
Regulatory & Competitive Sport Status
FDA Position
Hexarelin has not received FDA approval for any indication:
- Not approved for human or veterinary therapeutic use in the United States
- Not recognized as GRAS (Generally Recognized as Safe)
- Classification as research chemical only, not for human consumption
- No established medical use basis for therapeutic applications
- Development apparently discontinued by pharmaceutical companies for clinical use
The FDA has not issued specific warning letters regarding hexarelin to the same extent as some other research peptides, but its unapproved status means it cannot be legally marketed for human use.
WADA Prohibition
The World Anti-Doping Agency classifies hexarelin (examorelin) as a prohibited substance:
- Listed under Section S2 (Peptide Hormones, Growth Factors, Related Substances, and Mimetics)
- Specifically named among prohibited GH-releasing peptides (GHRPs) including examorelin, GHRP-1, GHRP-2, and GHRP-6
- Prohibited at all times (both in-competition and out-of-competition)
- No Therapeutic Use Exemptions (TUEs) available due to lack of approved therapeutic use
- Detection methods available for anti-doping testing programs
WADA’s prohibition reflects hexarelin’s classification as a growth hormone secretagogue with performance-enhancing potential.
Research Classification: Hexarelin is available only for laboratory research use. It is not intended for human consumption, medical use, or veterinary applications. All research must be conducted under appropriate ethical oversight and regulatory compliance with institutional review board approval where applicable.
Lead Researcher Spotlight
Romano Deghenghi, PhD
Former Chief Scientific Officer
Europeptides (Argenteuil, France) and Mediolanum Farmaceutici
Dr. Romano Deghenghi was the principal researcher who led the development and characterization of hexarelin in the early 1990s. Working with Europeptides and Mediolanum Farmaceutici, Dr. Deghenghi’s team synthesized hexarelin as a more stable analog of GHRP-6, incorporating the 2-methyl-D-tryptophan substitution that conferred enhanced chemical stability and prolonged biological activity. His pioneering work established hexarelin as one of the most potent growth hormone secretagogues in the GHRP family.
Dr. Deghenghi’s research contributions to hexarelin include:
- Chemical synthesis and optimization of the hexapeptide structure for enhanced stability
- Initial pharmacological characterization demonstrating superior potency compared to GHRP-6
- Pharmacokinetic and pharmacodynamic studies establishing dose-response relationships across species
- Identification of multi-receptor interactions including recognition of non-GHSR cardiac effects
- Collaboration with academic researchers worldwide to explore cardiovascular and metabolic applications
His work laid the foundation for three decades of subsequent research investigating hexarelin’s mechanisms and potential therapeutic applications, particularly in cardiovascular protection.
Disclaimer: This spotlight is provided for educational purposes to acknowledge scientific contributions to hexarelin research. Cenexa Labs has no affiliation with Dr. Deghenghi, Europeptides, Mediolanum Farmaceutici, or related institutions, and this information does not constitute an endorsement of any products or services.
References
- Deghenghi, R., Cananzi, M.M., Torsello, A., Battisti, C., Müller, E.E., & Locatelli, V. (1994). GH-releasing activity of hexarelin, a new growth hormone releasing peptide, in infant and adult rats. Life Sciences, 54(18), 1321-1328. PubMed
- Imbimbo, B.P., Mant, T., Edwards, M., Amin, D., Dalton, N., Boutignon, F., Lenaerts, V., Wüthrich, P., & Deghenghi, R. (1994). Growth hormone-releasing activity of hexarelin in humans. A dose-response study. European Journal of Clinical Pharmacology, 46(5), 421-425. PubMed
- Massoud, A.F., Hindmarsh, P.C., & Brook, C.G. (1996). Hexarelin-induced growth hormone, cortisol, and prolactin release: a dose-response study. Journal of Clinical Endocrinology and Metabolism, 81(12), 4338-4341. PubMed
- Korbonits, M., Kaltsas, G., Perry, L.A., Putignano, P., Grossman, A.B., Besser, G.M., & Trainer, P.J. (1999). The growth hormone secretagogue hexarelin stimulates the hypothalamo-pituitary-adrenal axis via arginine vasopressin. Journal of Clinical Endocrinology and Metabolism, 84(7), 2489-2495. PubMed
- Rahim, A., O’Neill, P.A., & Shalet, S.M. (1998). Growth hormone status during long-term hexarelin therapy. Journal of Clinical Endocrinology and Metabolism, 83(5), 1644-1649. PubMed
- Mao, Y., Tokudome, T., & Kishimoto, I. (2014). The cardiovascular action of hexarelin. Journal of Geriatric Cardiology, 11(3), 253-258. PubMed
- Bodart, V., Febbraio, M., Demers, A., McNicoll, N., Pohankova, P., Perreault, A., Sejlitz, T., Escher, E., Silverstein, R.L., Lamontagne, D., & Ong, H. (2002). CD36 mediates the cardiovascular action of growth hormone-releasing peptides in the heart. Circulation Research, 90(7), 844-849. PubMed
- McDonald, H., Peart, J., Kurniawan, N., Galloway, G., Royce, S., Samuel, C.S., & Chen, C. (2018). Hexarelin treatment preserves myocardial function and reduces cardiac fibrosis in a mouse model of acute myocardial infarction. Physiological Reports, 6(9), e13699. PubMed
- Mao, Y., Tokudome, T., Otani, K., Kishimoto, I., Nakanishi, M., Hosoda, H., Miyazato, M., & Kangawa, K. (2014). One dose of oral hexarelin protects chronic cardiac function after myocardial infarction. Hormone and Metabolic Research, 46(6), 406-416. PubMed
- Agbo, E., Liu, D., Li, M., Saahene, R.O., Chen, L., Zhao, L., Wang, Y., & Tian, G. (2019). Modulation of PTEN by hexarelin attenuates coronary artery ligation-induced heart failure in rats. Turkish Journal of Medical Sciences, 49(3), 945-958. PubMed
- Xu, X., Pang, J., Yin, H., Li, M., Hao, W., Chen, C., & Cao, J.M. (2012). Chronic administration of hexarelin attenuates cardiac fibrosis in the spontaneously hypertensive rat. American Journal of Physiology – Heart and Circulatory Physiology, 303(6), H703-711. PubMed
- Rossoni, G., Locatelli, V., Schweiger, F., Torsello, A., De Gennaro Colonna, V., Bernareggi, M., Deghenghi, R., Müller, E.E., & Berti, F. (1998). Growth hormone-independent cardioprotective effects of hexarelin in the rat. Endocrinology, 140(9), 4024-4031. PubMed
- Rodrigue-Way, A., Demers, A., Ong, H., & Tremblay, A. (2007). A growth hormone-releasing peptide promotes mitochondrial biogenesis and a fat burning-like phenotype through scavenger receptor CD36 in white adipocytes. Endocrinology, 148(3), 1009-1018. PubMed
- Chen, C., Wu, R., Zhao, Y., Tian, Y., Guo, Y., Wang, S., Xu, C., Liu, X., Wang, S., & Xu, H. (2017). Hexarelin, a growth hormone secretagogue, improves lipid metabolic aberrations in nonobese insulin-resistant male MKR mice. Endocrinology, 158(10), 3174-3187. PubMed
- Torsello, A., Bresciani, E., Rossoni, G., Avallone, R., Tulipano, G., Cocchi, D., Bulgarelli, I., Deghenghi, R., Berti, F., & Locatelli, V. (2003). Ghrelin plays a minor role in the physiological control of cardiac function in the rat. Endocrinology, 144(5), 1787-1792. PubMed
- Bedendi, I., Alloatti, G., Marcantoni, A., Malan, D., Catapano, F., Ghè, C., Deghenghi, R., Ghigo, E., & Muccioli, G. (2003). Cardiac effects of ghrelin and its endogenous derivatives des-octanoyl ghrelin and des-Gln14-ghrelin. European Journal of Pharmacology, 476(1-2), 87-95. PubMed
- Meanti, R., Rizzi, L., Bresciani, E., Molteni, L., Locatelli, V., & Torsello, A. (2023). Hexarelin modulation of MAPK and PI3K/Akt pathways in Neuro-2A cells inhibits hydrogen peroxide-induced apoptotic toxicity. International Journal of Molecular Sciences, 24(3), 2862. PubMed
- Conley, L.K., Teik, J.A., Deghenghi, R., Imbimbo, B.P., Giustina, A., Locatelli, V., & Wehrenberg, W.B. (1995). Mechanism of action of hexarelin and GHRP-6: analysis of the involvement of GHRH and somatostatin in the rat. Neuroendocrinology, 61(1), 44-50. PubMed
- Tivesten, A., Bollano, E., Caidahl, K., Kujacic, V., Sun, X.Y., Hedner, T., Hjalmarson, A., Bengtsson, B.A., & Isgaard, J. (2000). The growth hormone secretagogue hexarelin improves cardiac function in rats after experimental myocardial infarction. Endocrinology, 141(1), 60-66. PubMed
- Pang, J.J., Xu, R.K., Xu, X.B., Cao, J.M., Ni, C., Zhu, W.L., Asotra, K., Chen, M.C., & Chen, C. (2004). Hexarelin protects rat cardiomyocytes from angiotensin II-induced apoptosis in vitro. American Journal of Physiology – Heart and Circulatory Physiology, 286(3), H1063-1069. PubMed
- Westberg, C., Holmqvist, M., Roumi, M., Melin, I., Deghenghi, R., Wütrich, P., & Ong, H. (2001). Hexarelin – evaluation of factors influencing oral bioavailability and ways to improve absorption. Journal of Pharmacy and Pharmacology, 53(9), 1257-1264. PubMed
- Boghen, M.F., Meyers, C.A., Imbimbo, B.P., Cockle, S.M., Mant, T., Edwards, M., & Deghenghi, R. (1995). Radioimmunoassay for hexarelin, a peptidic growth hormone secretagogue, and its pharmacokinetic studies. Journal of Pharmaceutical and Biomedical Analysis, 13(10), 1275-1280. PubMed
- Mao, Y., Tokudome, T., Otani, K., Kishimoto, I., Miyazato, M., & Kangawa, K. (2013). Hexarelin treatment in male ghrelin knockout mice after myocardial infarction. Endocrinology, 154(10), 3847-3854. PubMed
- Locatelli, V., Rossoni, G., Schweiger, F., Torsello, A., De Gennaro Colonna, V., Bernareggi, M., Deghenghi, R., Müller, E.E., & Berti, F. (1999). Growth hormone-independent cardioprotective effects of hexarelin in the rat. Endocrinology, 140(9), 4024-4031. PubMed
- Deghenghi, R. (2008). Hexarelin: A multi-receptor peptide. Journal of Endocrinological Investigation, 31(7), 680. Article Link
All references open in new window. These citations are provided for educational and research purposes only. This information is not intended to diagnose, treat, cure, or prevent any disease. Hexarelin is intended for laboratory research use only.
The Cenexa Labs Gold Standard
Most peptide sites simply resell vials from overseas labs with little oversight or testing (Much of it is either fake or laced with contaminants). At Cenexa Labs, we manufacture our own peptides under strict USA-based standards…right here IN THE USA. From synthesis to lyophilization to final vial, every step is handled under our direct control — so you never have to question what you’re getting.
We might not be the cheapest, but you can count on our peptides being 100% legit and free from contaminants, heavy metals and toxins.
Why Researchers Choose Cenexa Labs
- End-to-End Chain of Custody: Every batch is logged, tested, and traceable — no middlemen, no relabeling, no guesswork.
- Lot-Linked COAs: Each vial’s lot number ties directly to third-party HPLC/MS results. No recycled or generic COAs.
- We’re the Manufacturer: Because we produce in-house, we control purity, potency, and compliance — instead of reselling from anonymous overseas labs.
- Verified Purity, Every Time: 99%+ purity confirmed on every batch by independent labs, not just claimed on a label.
- GMP-Aligned, USA Based: Manufactured domestically in controlled GMP, ISO 9001-audited facilities.
- Fast, Reliable Fulfillment: Orders placed by 2pm CST ship the same business day. Free USPS Priority on orders $300+. $9.95 Flat rate shipping on all other orders with 2-3 day delivery.
- Backed by Trust: Over 18,000 researchers nationwide rely on Cenexa Labs for consistent, verifiable peptides.
- Room Temperature (Unmixed): Lyophilized (powder) peptides are stable for 3–4 months at room temperature if kept sealed and away from direct light.
- Freezer (Unmixed): For long-term storage, place vials in a freezer. Depending on temperature, peptides can remain stable for 1–3 years.
- After Reconstitution: Once mixed with bacteriostatic water, peptides must be stored in the refrigerator and remain stable for up to 30 days.
All Cenexa peptides are manufactured 100% end-to-end here in the USA using the Lyophilization (Freeze Drying) process. This ensures maximum stability and quality.
Best Practice:
Only reconstitute your peptides when you’re ready to begin using them. Until then, keep vials in their lyophilized powder form, stored in the freezer and away from light.
Fast Processing: We strive to ship same-day. During high-volume times it may take 2–3 days for your package to enter the mailstream. (You’ll see a notice at checkout and can upgrade if you need guaranteed same-day shipping.)
- Flat Rate Shipping: $9.95 on all orders (USPS Priority Mail 2–3 days).
- Free Shipping: Orders over $300 ship free.
- Expedited Options: Faster methods available at checkout.
Important: Orders paid by eCheck won’t ship until payment clears our bank (usually 2–3 business days after it leaves your account).
All products are carefully packaged for safe arrival.
Need help with your order or delivery?
- Call us at +1 800 123 4567
- [email protected]
See What Some Of Our 18,000+ Happy Customers Have To Say…
Related products
-
Peptides
GLP2
$46.99 – $324.99Price range: $46.99 through $324.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
KPV
$69.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
GRHP-6
$24.99 – $34.99Price range: $24.99 through $34.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
AOD-9604
$49.99 Select options This product has multiple variants. The options may be chosen on the product page






