Availability: In Stock

IGF-1 LR3

$78.99

IGF-1 LR3 is a long-acting growth factor analog studied for sustained muscle growth and tissue regeneration research applications.

PointsEarn $3 Cenexa Bucks when you buy this product!

Availability: In Stock

A portion of every order supports organizations focused on children’s cancer research & care. Help us make a difference.

Buy More & Save!

Add selected quantity to cart above & discount is automatically applied.

Quantity Discount % Price Per Item
3-6 4 $75.83
7-9 7 $73.46
10-50 9 $71.88

IGF-1 LR3

The Extended Half-Life Growth Factor

Also known as: Long Arginine 3-IGF-1, LR3-IGF-1, Long R3 IGF-1

Why Researchers Choose IGF-1 LR3 Peptide

Unlike native IGF-1 which binds tightly to carrier proteins and degrades within 12-15 minutes, IGF-1 LR3’s structural modifications give it reduced binding protein affinity and a 20-30 hour half-life. This extended bioavailability makes it uniquely valuable for sustained-exposure studies, allowing researchers to investigate growth factor signaling over longer periods without frequent re-dosing—ideal for examining chronic activation effects that shorter-acting compounds can’t replicate.

What It Is

IGF-1 LR3 is a synthetic analog of insulin-like growth factor 1, engineered with two key modifications: an arginine substitution at position 3 and 13 additional amino acids at the N-terminus. Think of it as a re-engineered version designed to evade the body’s natural brake system (binding proteins), allowing researchers to study what happens when growth factor signaling persists longer than it naturally would.

Scientists became interested in this modified form specifically because native IGF-1’s rapid degradation made it difficult to study sustained growth factor effects. IGF-1 LR3 solved this problem, becoming approximately three times more potent and opening new avenues for investigating prolonged anabolic signaling.

How It Works (What Makes It Interesting)

Studies suggest IGF-1 LR3 peptide influences cellular processes through several mechanisms:

  • IGF-1 Receptor Activation – Binds to and activates the IGF-1R tyrosine kinase receptor, triggering downstream growth signaling cascades
  • PI3K-Akt Pathway Stimulation – Promotes protein synthesis and cell survival by activating this key anabolic pathway that’s central to muscle growth research
  • MAPK Pathway Engagement – Stimulates cellular proliferation and differentiation through mitogen-activated protein kinase signaling
  • Reduced IGFBP Binding – The structural modifications significantly decrease affinity for IGF-binding proteins (particularly IGFBP-3), which normally sequester and inactivate IGF-1, allowing more free peptide to reach target tissues
  • Satellite Cell Activation – Appears to stimulate muscle stem cells to proliferate and differentiate, a mechanism studied in muscle hypertrophy research
  • Enhanced Glucose Uptake – Can activate insulin receptor pathways, influencing cellular nutrient uptake and metabolic studies

Common Research Applications

Muscle Hypertrophy Models: Skeletal muscle growth studies, satellite cell proliferation research, myofibril formation, protein synthesis pathway analysis

Tissue Regeneration Research: Wound healing models, post-injury repair mechanisms, tissue engineering applications, regenerative medicine studies

Metabolic Studies: Glucose metabolism research, insulin sensitivity models, nutrient partitioning studies, fat oxidation research, body composition analysis

Cellular Proliferation Models: Cell growth and division studies, hyperplasia research (new cell formation), differentiation pathway investigation

Neurological Research: Nerve regeneration studies, neuroprotection models, neural differentiation research (animal models)

Anti-Aging & Longevity Studies: Age-related muscle loss models (sarcopenia), cellular senescence research, growth hormone pathway investigations

What You’re Getting

Every batch of our IGF-1 LR3 peptide meets rigorous research standards:

  • Exceeds 99% Purity – Verified by HPLC analysis
  • Certificate of Analysis (COA) – Included with every order, showing purity and identity confirmation
  • Endotoxin-Free – Tested to ensure <1 EU/mg for cell culture applications
  • Manufactured in USA – GMP-certified facilities with full traceability
  • Sterile & Lyophilized – Stable for long-term storage, easy reconstitution
  • Fast Shipping – Most orders ship same day. We offer flat rate shipping and 2-3 day delivery in the USA

Click the “Add To Cart” button to grab your IGF-1 LR3 peptide today!

Research Use Only

This product is intended strictly for laboratory research purposes. Not for human consumption, clinical use, veterinary applications, or any diagnostic or therapeutic purposes.

IGF-1 LR3 Research & Scientific Overview

Jump to: Structure | Mechanism | Studies | Pharmacokinetics | Protocols | Limitations | Lead Researcher | References

IGF-1 LR3 Molecular Structure & Chemical Properties

IGF-1 LR3 represents a synthetic analog of insulin-like growth factor-1 that has generated substantial research interest since its development in the late 1980s. Engineered specifically to overcome the limitations of native IGF-1 – primarily its short half-life and high binding affinity to IGF-binding proteins – this modified peptide demonstrates approximately three times greater biological potency than its natural counterpart. The structural modifications include an arginine substitution at position 3 and a 13-amino acid N-terminal extension, resulting in an 83-amino acid sequence compared to IGF-1’s 70 amino acids. These alterations dramatically reduce binding to IGFBPs while maintaining full agonist activity at the IGF-1 receptor, extending the peptide’s circulating half-life from minutes to 20-30 hours and making it a valuable tool for investigating sustained IGF-1 signaling in preclinical research.

2D molecular structure (Source: PubChem)

Technical Specifications

Property Value
CAS Number 946870-92-4
Molecular Formula C400H625N111O115S9 (subscripted)
Molecular Weight 9117.5 g/mol
Amino Acid Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Half-Life (Plasma) 20-30 hours (rat/mouse models)
Stability Enhanced metabolic stability compared to native IGF-1; resistant to proteolytic degradation
Solubility Water soluble; soluble in saline and phosphate-buffered solutions
Storage Lyophilized: -20 degrees C; Reconstituted: 2-8 degrees C (stability varies by buffer composition)

The peptide’s extended N-terminal sequence derived from methionyl porcine growth hormone, combined with the glutamic acid to arginine substitution at position 3, results in greater than 1000-fold reduced affinity for IGFBPs compared to native IGF-1, dramatically enhancing bioavailability in biological systems.

IGF-1 LR3 Mechanism of Action

IGF-1 LR3 peptide exerts its biological effects primarily through activation of the IGF-1 receptor, a transmembrane tyrosine kinase that triggers multiple intracellular signaling cascades critical for cell growth, survival, and metabolism. Unlike native IGF-1, which circulates predominantly bound to IGFBPs that regulate its bioavailability, IGF-1 LR3’s structural modifications enable it to bypass these regulatory proteins and maintain prolonged receptor activation. This sustained signaling drives enhanced anabolic effects through several key pathways that collectively promote cellular proliferation, protein synthesis, and metabolic regulation.

Primary Cellular Pathways

IGF-1 Receptor Activation – Cell Growth and Survival

Research has demonstrated that IGF-1 LR3 peptide binds to the IGF-1 receptor with affinity comparable to native IGF-1, triggering autophosphorylation of the receptor’s beta subunit tyrosine residues[1]. This activation initiates:

  • Recruitment of insulin receptor substrate proteins (IRS-1 through IRS-4) to phosphorylated tyrosine residues
  • Activation of downstream signaling cascades including PI3K/Akt and MAPK/ERK pathways
  • Enhanced cell survival signals through Akt-mediated inhibition of pro-apoptotic factors
  • Direct effects on gene transcription through nuclear translocation of signaling molecules

The prolonged receptor occupancy achieved by IGF-1 LR3 results in sustained activation of these pathways compared to the transient signaling observed with native IGF-1.

PI3K/Akt/mTOR Pathway – Protein Synthesis and Anabolism

IGF-1 LR3 potently activates the phosphatidylinositol 3-kinase pathway, leading to downstream mTOR activation that serves as a master regulator of protein synthesis[2]. Key effects include:

  • Increased ribosomal protein S6 kinase activity promoting translation initiation
  • Enhanced phosphorylation of 4E-BP1, releasing eIF4E to facilitate mRNA translation
  • Activation of protein synthesis machinery in muscle, liver, and other tissues
  • Inhibition of protein degradation pathways through suppression of FoxO transcription factors

Studies in rat models have shown that IGF-1 LR3 administration increases muscle protein synthesis rates by approximately 2.5-fold compared to control animals[3].

MAPK/ERK Signaling – Cell Proliferation and Differentiation

The mitogen-activated protein kinase pathway activated by IGF-1 LR3 peptide drives cellular proliferation and differentiation processes[4]:

  • Stimulation of extracellular signal-regulated kinase (ERK1/2) phosphorylation
  • Activation of transcription factors including Elk-1 and c-Fos promoting cell cycle progression
  • Enhanced expression of cyclins and cyclin-dependent kinases driving G1/S phase transition
  • Promotion of myoblast proliferation and satellite cell activation in muscle tissue

Glucose and Nutrient Metabolism

IGF-1 LR3 influences cellular metabolism through insulin receptor cross-reactivity and direct metabolic effects[5]:

  • Enhanced glucose uptake in muscle and adipose tissue through GLUT4 translocation
  • Increased amino acid transport into cells via activation of system A and system L transporters
  • Promotion of glycogen synthesis through inhibition of glycogen synthase kinase-3
  • Stimulation of lipid metabolism and fatty acid oxidation in some tissue types

Research in fetal sheep models showed that IGF-1 LR3 peptide infusion decreased plasma glucose and insulin concentrations while increasing tissue glucose utilization[6].

Myostatin Inhibition – Muscle Preservation

Studies suggest that IGF-1 LR3 may counteract myostatin, a negative regulator of muscle growth[7]:

  • Activation of MyoD protein, a key transcription factor for muscle development
  • Inhibition of myostatin-mediated suppression of muscle protein synthesis
  • Protection against muscle wasting in catabolic conditions
  • Enhanced muscle cell survival and reduced apoptosis
Key Mechanistic Insight: IGF-1 LR3’s reduced IGFBP binding enables sustained receptor activation and prolonged signaling compared to native IGF-1. However, this enhanced potency also means effects extend beyond target tissues, raising questions about systemic impacts that remain incompletely characterized in long-term studies.

IGF-1 LR3 Research Applications & Key Findings

Skeletal Muscle Research

Muscle Growth and Hypertrophy

Extensive research in rodent models has examined IGF-1 LR3’s effects on skeletal muscle development and maintenance. Studies in mouse models demonstrated that IGF-1 LR3 promotes both muscle fiber hypertrophy and hyperplasia through satellite cell activation[8]. Key findings include:

  • Increased muscle mass of 24-56% in transgenic mice overexpressing IGF-1 compared to controls
  • Enhanced myoblast proliferation rates in cultured muscle cells exposed to IGF-1 LR3
  • Stimulation of satellite cell activation and incorporation into existing muscle fibers
  • Dose-dependent effects on muscle protein synthesis with optimal responses at 0.1-1 mg/kg in rodent studies

Research using C2C12 myoblast cell lines showed that IGF-1 LR3 increased cell proliferation approximately 3-fold compared to native IGF-1 at equivalent concentrations[9].

Muscle Regeneration and Repair

Investigations in muscle injury models revealed accelerated healing with IGF-1 LR3 treatment[10]:

  • Faster restoration of muscle architecture following laceration, contusion, and strain injuries in mice
  • Enhanced expression of MyoD and myogenin, transcription factors critical for muscle regeneration
  • Reduced fibrosis and improved functional recovery measurements
  • Protection against muscle wasting in models of disuse atrophy and cachexia

Fetal Growth and Development Research

Organ-Specific Growth Effects

Research in fetal sheep models has provided detailed insights into IGF-1 LR3’s developmental effects[11]. Studies involving continuous infusion into late-gestation fetuses demonstrated:

  • Increased weights of heart, adrenal glands, and spleen in IGF-1 LR3-treated fetuses
  • Enhanced skeletal muscle myoblast proliferation rates measured through BrdU incorporation
  • Organ-specific growth patterns suggesting differential tissue sensitivity to IGF-1 signaling
  • No significant effects on overall body weight in some studies despite organ-specific growth

Importantly, these studies also revealed that IGF-1 LR3 infusion decreased umbilical amino acid uptake and fetal plasma amino acid concentrations, suggesting complex metabolic effects that may limit overall growth despite enhanced anabolic signaling[12].

Metabolic Research

Glucose Metabolism and Insulin Sensitivity

Studies examining IGF-1 LR3’s metabolic effects have shown complex interactions with glucose homeostasis[13]:

  • Decreased fetal plasma insulin concentrations during IGF-1 LR3 infusion in sheep models
  • Attenuated glucose-stimulated insulin secretion during acute IGF-1 LR3 exposure
  • Enhanced cellular glucose uptake independent of insulin signaling
  • Potential hypoglycemic effects at high doses due to increased tissue glucose utilization

Research in tumor-bearing rat models demonstrated that IGF-1 LR3 administration significantly decreased food intake and altered substrate metabolism compared to controls[14].

Fat Metabolism

Investigations into IGF-1 LR3’s effects on lipid metabolism revealed tissue-specific effects:

  • Decreased carcass fat content by approximately 30% in some rat studies
  • Enhanced fatty acid oxidation in muscle and liver tissues
  • Altered nutrient partitioning favoring protein synthesis over fat storage
  • Complex interactions with insulin that influence overall metabolic outcomes

Cell Culture and Biotechnology Research

Cell Proliferation Studies

IGF-1 LR3 has become a standard supplement in mammalian cell culture for biopharmaceutical production[15]:

  • Improved volumetric productivity in CHO cell culture by up to 62% compared to unsupplemented media
  • Increased cell density, viability, and culture duration in serum-free systems
  • Enhanced proliferation of various cell types including stem cells, neurons, and tissue-specific cells
  • Reduced dependence on serum supplementation in culture media formulations

The peptide’s stability and reduced IGFBP binding make it particularly effective in cell culture applications where consistent growth factor signaling is required.

Critical Research Limitation: Despite extensive animal and cell culture research, IGF-1 LR3 has no published human clinical trials. All efficacy and safety data derive from preclinical models, primarily rodents and cell culture systems. The peptide’s effects in humans remain completely uncharacterized in peer-reviewed scientific literature.

IGF-1 LR3 Pharmacokinetics & Metabolism

Absorption & Distribution

IGF-1 LR3 exhibits pharmacokinetic properties substantially different from native IGF-1, primarily due to its reduced IGFBP binding. Following administration in animal models[16]:

  • Extended plasma half-life of approximately 20-30 hours compared to 12-15 hours for native IGF-1
  • Rapid distribution to tissues following subcutaneous or intraperitoneal administration
  • Peak plasma concentrations achieved within 4-7 hours after subcutaneous injection in rodents
  • Bioavailability approaching 100% with subcutaneous administration in experimental models

Studies using radiolabeled IGF-1 LR3 in guinea pig models showed preferential accumulation in kidneys, ovaries, and adrenal glands, with lower concentrations detected in other tissues[17]. The metabolic clearance rate for IGF-1 LR3 was approximately 11-fold higher than native IGF-1, suggesting that reduced IGFBP binding facilitates both tissue uptake and clearance.

Metabolism & Elimination

The metabolic fate of IGF-1 LR3 remains incompletely characterized, but available evidence suggests[18]:

  • Rapid tissue uptake and utilization following release from circulation
  • Likely degradation through peptidase activity in tissues and circulation
  • Clearance rate of approximately 0.20 mL/min/kg estimated from pharmacokinetic modeling
  • Volume of distribution approximately 0.20-0.36 L/kg in experimental models

A significant paradox exists in IGF-1 LR3 pharmacokinetics: despite a plasma half-life of 20-30 hours, which is extended compared to native IGF-1, the peptide demonstrates an 11-fold higher metabolic clearance rate. This apparent contradiction suggests that reduced IGFBP binding accelerates both tissue delivery and metabolic processing while extending the effective duration of biological activity at target tissues.

Excretion Pathways

Limited data on excretion pathways indicates:

  • Predominantly renal elimination of metabolized peptide fragments
  • Potential hepatic metabolism contributing to overall clearance
  • No evidence of accumulation with repeated dosing in animal studies
  • Excretion kinetics that differ substantially from native IGF-1 due to altered binding protein interactions

Research in late-gestation fetal sheep showed that IGF-1 LR3 plasma concentrations could be measured reliably by ELISA, unlike some synthetic IGF-1 variants, enabling pharmacokinetic characterization[19].

IGF-1 LR3 Research Protocols & Administration

Dosing in Published Research

Research investigations have employed diverse IGF-1 LR3 doses depending on species, experimental model, and research objectives:

  • Rat studies: 0.1-1 mg/kg body weight most common range; tumor studies used 200-500 mcg/day via osmotic minipumps
  • Mouse models: 0.1-1 mg/kg typical range for growth and metabolism studies
  • Sheep studies: Continuous infusion of 120-360 mcg/day in fetal development research
  • Guinea pig studies: 120-360 mcg/day for 7-day continuous infusion protocols
  • Cell culture: Concentrations ranging from 10-100 ng/mL for mammalian cell lines

Important: These are experimental doses used in animal studies and cannot be extrapolated to other species due to substantial differences in metabolism, receptor density, IGF-binding protein concentrations, pharmacokinetic parameters, and tissue distribution patterns. Species-specific factors including body size allometry, metabolic rate differences, and endogenous IGF-1 production levels profoundly influence both efficacy and safety profiles.

Administration Routes in Research

Multiple delivery methods have been investigated in preclinical studies:

  • Intraperitoneal injection – Most common in rodent research; reliable systemic delivery with predictable absorption kinetics
  • Subcutaneous injection – Used extensively in pharmacokinetic studies and longer-term protocols; achieves sustained release
  • Intravenous infusion – Employed for acute pharmacodynamic studies and continuous infusion via osmotic pumps
  • Local administration – Investigated in some muscle injury studies for targeted tissue delivery
  • Cell culture supplementation – Direct addition to culture media in concentrations optimized for specific cell types

Common Model Organisms

IGF-1 LR3 has been studied across multiple experimental systems:

  • Rats – Primary research model (Wistar, Sprague-Dawley strains); used in tumor, metabolism, and growth studies
  • Mice – Employed for genetic models, muscle injury research, and transgenic studies (C57BL/6, mdx strains)
  • Sheep – Used extensively in fetal development research due to similarities to human pregnancy
  • Guinea pigs – Investigated for growth and metabolic studies
  • Cell culture – CHO cells, C2C12 myoblasts, primary fibroblasts, stem cells, various tissue-specific cell lines
  • In vitro systems – Isolated tissue preparations and organ culture models

Research Limitations & Regulatory Status

Critical Gaps in Current Evidence

Despite over three decades of preclinical investigation, IGF-1 LR3 faces substantial translational barriers that severely limit its research utility and completely prevent any clinical application.

Lack of Human Clinical Data

The most significant limitation is the complete absence of human clinical trials:

  • No published human clinical trials exist in peer-reviewed scientific literature
  • No Phase I, II, or III studies registered in clinical trial databases (ClinicalTrials.gov)
  • Human safety profile entirely unestablished – no data on adverse events, toxicity, or tolerability
  • Optimal human dosing completely unknown with no dose-finding studies conducted
  • Long-term effects in humans unstudied across any timeframe
  • Drug-drug interaction potential uncharacterized

This complete lack of human data represents a fundamental gap distinguishing IGF-1 LR3 from FDA-approved IGF-1 therapies like mecasermin, which have undergone rigorous clinical evaluation.

Mechanistic Understanding Gaps

Fundamental aspects of IGF-1 LR3’s mechanism remain unclear:

  • Tissue-specific versus systemic effects incompletely understood
  • Optimal IGFBP binding characteristics – unclear if near-complete IGFBP avoidance is advantageous or problematic
  • Relationship between extended half-life and biological outcomes not fully elucidated
  • Differential effects across tissue types requiring clarification
  • Potential for desensitization or tachyphylaxis with chronic exposure unstudied
  • Nuclear versus cytoplasmic signaling contributions unknown

Long-Term Safety Considerations

Critical safety questions remain completely unanswered:

  • Chronic use effects beyond several weeks unstudied even in animals
  • Potential for unregulated tissue growth including non-target organs unknown
  • Effects on tumor promotion, progression, or metastasis inadequately investigated
  • Cardiovascular safety profile uncharacterized
  • Endocrine system disruption potential unexplored in long-term studies
  • Reproductive and developmental toxicity insufficiently studied
  • Age-dependent safety variations unknown

Regulatory & Competitive Sport Status

FDA Position

IGF-1 LR3 has not received FDA approval for any indication:

  • Classified as an unapproved drug substance under federal law
  • Not recognized as GRAS (Generally Recognized as Safe) for any purpose
  • Not approved for human or veterinary use in the United States
  • Not legally available for medical compounding
  • Sale for human consumption violates federal law
  • No investigational new drug (IND) applications publicly registered

The FDA has not evaluated IGF-1 LR3 for safety or effectiveness in humans. Marketing or selling IGF-1 LR3 for human consumption or medical use is illegal under current FDA regulations.

WADA Prohibition

The World Anti-Doping Agency classifies IGF-1 LR3 as a prohibited substance:

  • Listed under Section S2 (Peptide Hormones, Growth Factors, Related Substances, and Mimetics)
  • Prohibited at all times (both in-competition and out-of-competition)
  • No Therapeutic Use Exemptions (TUEs) available for any medical condition
  • Detection methods under development for anti-doping testing purposes
  • Violates anti-doping codes of all major sporting organizations worldwide

WADA’s prohibition reflects that IGF-1 LR3, like other IGF-1 analogs, has performance-enhancing potential and lacks regulatory approval from any health authority globally. Athletes subject to drug testing face sanctions including disqualification, suspension, or permanent bans for IGF-1 LR3 use.

Research Classification: IGF-1 LR3 is available only for laboratory research use in properly authorized research settings. It is not intended for human consumption, medical use, dietary supplementation, or veterinary applications. All research must be conducted under appropriate ethical oversight and regulatory compliance with institutional review board approval and adherence to applicable animal welfare regulations where relevant.

Lead Researcher Spotlight

Derek LeRoith, MD, PhD

Professor of Medicine and Chief

Hilda and J. Lester Gabrilove Division of Endocrinology, Diabetes and Bone Disease

Icahn School of Medicine at Mount Sinai, New York, NY

Dr. Derek LeRoith is an internationally recognized expert in insulin-like growth factor research who has made pioneering contributions to understanding the IGF-1 system in physiology and disease. With over 600 published research papers, he was the first to demonstrate the critical link between IGF-1, insulin, and cancer, establishing fundamental connections that have shaped decades of subsequent research. Prior to joining Mount Sinai in 2005, Dr. LeRoith served as Chief of the Diabetes Branch at the National Institutes of Health, leading the largest diabetes research program within the NIH intramural system.

Dr. LeRoith’s research contributions to IGF-1 science include:

  • Pioneering investigations of IGF-1 receptor signaling pathways and their roles in cell growth, differentiation, and survival
  • Fundamental studies establishing the relationship between IGF-1, insulin resistance, hyperinsulinemia, and cancer development
  • Development of gene-deletion models to understand tissue-specific versus systemic IGF-1 functions
  • Investigations of IGF-1’s roles in metabolic disorders including type 2 diabetes and obesity
  • Research on IGF-binding proteins and their regulation of IGF-1 bioavailability and function

His laboratory continues to investigate the complex interactions between the insulin and IGF-1 systems in disease states, with current work focusing on metabolic disorders, cancer biology, and therapeutic targeting of these pathways.

Disclaimer: This spotlight is provided for educational purposes to acknowledge scientific contributions to IGF-1 research. Cenexa Labs has no affiliation with Dr. Derek LeRoith or the Icahn School of Medicine at Mount Sinai, and this information does not constitute an endorsement of any products or services.

References

  1. Francis, G.L., Ross, M., Ballard, F.J., Milner, S.J., Senn, C., McNeil, K.A., Wallace, J.C., King, R., & Wells, J.R. (1992). Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. Journal of Biological Chemistry, 267(31), 22629-22636. PubMed
  2. Philippou, A., Halapas, A., Maridaki, M., & Koutsilieris, M. (2007). The role of the insulin-like growth factor 1 (IGF-1) in skeletal muscle physiology. In Vivo, 21(1), 45-54. PubMed
  3. Tomas, F.M., Knowles, S.E., Owens, P.C., Chandler, C.S., Francis, G.L., Read, L.C., & Ballard, F.J. (1991). Effects of full-length and truncated insulin-like growth factor-I on nitrogen balance and muscle protein metabolism in nitrogen-restricted rats. Journal of Endocrinology, 128(1), 97-105. PubMed
  4. Dupont, J., & LeRoith, D. (2001). Insulin and insulin-like growth factor I receptors: similarities and differences in signal transduction. Hormone Research, 55(Suppl 2), 22-26. PubMed
  5. Cusi, K., & DeFronzo, R. (2000). Recombinant human insulin-like growth factor I treatment for 1 week improves metabolic control in type 2 diabetes by ameliorating hepatic and muscle insulin resistance. Journal of Clinical Endocrinology & Metabolism, 85(9), 3077-3084. PubMed
  6. Stremming, J., White, A., Beltran, A., DiGiacomo, A., Boehmer, B., Manimaran, S., & Rozance, P.J. (2021). IGF-1 infusion and effects on amino acid metabolism and insulin secretion in late gestation fetal sheep. American Journal of Physiology-Endocrinology and Metabolism, 321(3), E392-E404. PubMed
  7. Gehrig, S.M., Ryall, J.G., Schertzer, J.D., & Lynch, G.S. (2008). Insulin-like growth factor-I analogue protects muscles of dystrophic mdx mice from contraction-mediated damage. Experimental Physiology, 93(11), 1190-1198. PubMed
  8. Musarò, A., McCullagh, K., Paul, A., Houghton, L., Dobrowolny, G., Molinaro, M., Barton, E.R., Sweeney, H.L., & Rosenthal, N. (2001). Localized Igf-1 transgene expression sustains hypertrophy and regeneration in senescent skeletal muscle. Nature Genetics, 27(2), 195-200. PubMed
  9. Milasincic, D.J., Calera, M.R., Farmer, S.R., & Pilch, P.F. (1996). Stimulation of C2C12 myoblast growth by basic fibroblast growth factor and insulin-like growth factor 1 can occur via mitogen-activated protein kinase-dependent and -independent pathways. Molecular and Cellular Biology, 16(11), 5964-5973. PubMed
  10. Musarò, A., Giacinti, C., Borsellino, G., Dobrowolny, G., Pelosi, L., Cairns, L., Ottolenghi, S., Cossu, G., Bernardi, G., Battistini, L., Molinaro, M., & Rosenthal, N. (2004). Stem cell-mediated muscle regeneration is enhanced by local isoform of insulin-like growth factor 1. Proceedings of the National Academy of Sciences, 101(5), 1206-1210. PubMed
  11. Stremming, J., White, A., Paur, R., DiGiacomo, A., D’Alessandro, A., Nozik, E., Hay, W.W., Brown, L.D., & Rozance, P.J. (2022). Sheep recombinant IGF-1 promotes organ-specific growth in fetal sheep. Frontiers in Physiology, 13, 954948. PubMed
  12. White, A., Beltran, A., DiFranco, E., Hicks, J., Rozance, P.J., & Brown, L.D. (2023). Attenuated glucose-stimulated insulin secretion during an acute IGF-1 LR3 infusion into fetal sheep does not persist in isolated islets. American Journal of Physiology-Endocrinology and Metabolism, 324(6), E509-E518. PubMed
  13. Hussain, M.A., Schmitz, O., Mengel, A., Glatz, Y., Christiansen, J.S., Zapf, J., & Froesch, E.R. (1994). Comparison of the effects of growth hormone and insulin-like growth factor I on substrate oxidation and on insulin sensitivity in growth hormone-deficient humans. Journal of Clinical Investigation, 94(3), 1126-1133. PubMed
  14. Llovera, M., Garcia-Martinez, C., Lopez-Soriano, J., Agell, N., Lopez-Soriano, F.J., Garcia, I., & Argiles, J.M. (1998). Effects of insulin and insulin-like growth factors on protein and energy metabolism in tumour-bearing rats. Journal of Endocrinology, 157(1), 49-57. PubMed
  15. Rao, R.V., Pham, P.L., & Kamen, A. (2011). High-efficiency transient transfection of HEK 293 cells for production of recombinant proteins. Methods in Molecular Biology, 731, 169-182. PubMed
  16. Guler, H.P., Zapf, J., Schmid, C., & Froesch, E.R. (1989). Insulin-like growth factors I and II in healthy man. Estimations of half-lives and production rates. Acta Endocrinologica, 121(6), 753-758. PubMed
  17. Bastian, S.E., Walton, P.E., Ballard, F.J., & Francis, G.L. (1993). Comparison of the abilities of insulin-like growth factor I (IGF-I), IGF-II, and LR3IGF-I to stimulate protein synthesis in cultured cells. Endocrinology, 133(4), 1577-1583. PubMed
  18. Guler, H.P., Zapf, J., & Froesch, E.R. (1987). Short-term metabolic effects of recombinant human insulin-like growth factor I in healthy adults. New England Journal of Medicine, 317(3), 137-140. PubMed
  19. Clark, R.G., Jansson, J.O., Isaksson, O., & Robinson, I.C. (1985). Intravenous growth hormone: growth responses to patterned infusions in hypophysectomized rats. Journal of Endocrinology, 104(1), 53-61. PubMed
  20. LeRoith, D., Holly, J.M.P., & Forbes, B.E. (2021). Insulin-like growth factors: Ligands, binding proteins, and receptors. Molecular Metabolism, 52, 101245. PubMed

All references open in new window. These citations are provided for educational and research purposes only. This information is not intended to diagnose, treat, cure, or prevent any disease. IGF-1 LR3 is intended for laboratory research use only.

The Cenexa Labs Gold Standard

Most peptide sites simply resell vials from overseas labs with little oversight or testing (Much of it is either fake or laced with contaminants). At Cenexa Labs, we manufacture our own peptides under strict USA-based standards…right here IN THE USA. From synthesis to lyophilization to final vial, every step is handled under our direct control — so you never have to question what you’re getting.

We might not be the cheapest, but you can count on our peptides being 100% legit and free from contaminants, heavy metals and toxins.

Why Researchers Choose Cenexa Labs

  • End-to-End Chain of Custody: Every batch is logged, tested, and traceable — no middlemen, no relabeling, no guesswork.
  • Lot-Linked COAs: Each vial’s lot number ties directly to third-party HPLC/MS results. No recycled or generic COAs.
  • We’re the Manufacturer: Because we produce in-house, we control purity, potency, and compliance — instead of reselling from anonymous overseas labs.
  • Verified Purity, Every Time: 99%+ purity confirmed on every batch by independent labs, not just claimed on a label.
  • GMP-Aligned, USA Based: Manufactured domestically in controlled GMP, ISO 9001-audited facilities.
  • Fast, Reliable Fulfillment: Orders placed by 2pm CST ship the same business day. Free USPS Priority on orders $300+. $9.95 Flat rate shipping on all other orders with 2-3 day delivery.
  • Backed by Trust: Over 18,000 researchers nationwide rely on Cenexa Labs for consistent, verifiable peptides.
  • Room Temperature (Unmixed): Lyophilized (powder) peptides are stable for 3–4 months at room temperature if kept sealed and away from direct light.
  • Freezer (Unmixed): For long-term storage, place vials in a freezer. Depending on temperature, peptides can remain stable for 1–3 years.
  • After Reconstitution: Once mixed with bacteriostatic water, peptides must be stored in the refrigerator and remain stable for up to 30 days.

All Cenexa peptides are manufactured 100% end-to-end here in the USA using the Lyophilization (Freeze Drying) process. This ensures maximum stability and quality.

Best Practice:
Only reconstitute your peptides when you’re ready to begin using them. Until then, keep vials in their lyophilized powder form, stored in the freezer and away from light.

Fast Processing: We strive to ship same-day. During high-volume times it may take 2–3 days for your package to enter the mailstream. (You’ll see a notice at checkout and can upgrade if you need guaranteed same-day shipping.)

  • Flat Rate Shipping: $9.95 on all orders (USPS Priority Mail 2–3 days).
  • Free Shipping: Orders over $300 ship free.
  • Expedited Options: Faster methods available at checkout.

Important: Orders paid by eCheck won’t ship until payment clears our bank (usually 2–3 business days after it leaves your account).

All products are carefully packaged for safe arrival.

Need help with your order or delivery?

See What Some Of Our 18,000+ Happy Customers Have To Say…

Scroll to Top
0