LL37
$89.99
LL-37 is the only human cathelicidin antimicrobial peptide studied for broad-spectrum microbial defense and immune system modulation.
Earn $4 Cenexa Bucks when you buy this product!Availability: In Stock
A portion of every order supports organizations focused on children’s cancer research & care. Help us make a difference.
Buy More & Save!
Add selected quantity to cart above & discount is automatically applied.
| Quantity | Discount % | Price Per Item |
|---|---|---|
| 3-6 | 4 | $86.39 |
| 7-9 | 7 | $83.69 |
| 10-50 | 9 | $81.89 |
Quick Links
LL-37
The Only Human Cathelicidin – Multi-Mechanism Host Defense Peptide
Also known as: hCAP18, FALL-39, Cathelicidin Antimicrobial Peptide
Why Researchers Choose LL-37
Unlike most antimicrobial peptides that work through a single mechanism, LL-37 operates through multiple complementary pathways—direct membrane disruption, immune cell recruitment, biofilm penetration, and immunomodulation. This makes it uniquely valuable for researchers studying host-pathogen interactions, innate immunity, and the complex interplay between antimicrobial action and immune regulation.
What It Is
LL-37 peptide is the only cathelicidin antimicrobial peptide expressed in humans, cleaved from the precursor protein hCAP18. It’s produced by neutrophils and epithelial cells as a first-line defense molecule at sites of infection and inflammation.
Researchers became interested because LL-37 doesn’t just kill microbes—it orchestrates immune responses, modulates inflammation, and plays surprising roles in wound healing and cancer biology, making it far more than a simple antimicrobial agent.
How It Works (What Makes It Interesting)
Studies suggest LL-37 peptide influences host defense and cellular processes through several mechanisms:
- Membrane disruption – Forms oligomeric structures and channels in bacterial membranes via a carpet-like mechanism, causing rapid permeabilization of both outer and inner membranes
- LPS neutralization – Binds and neutralizes bacterial endotoxins (lipopolysaccharide), reducing inflammatory responses to gram-negative bacteria
- Biofilm penetration – Penetrates established bacterial biofilms and disrupts embedded bacteria, showing efficacy against biofilm-associated infections
- Immune cell chemotaxis – Activates formyl peptide receptor-like 1 (FPRL1) to recruit neutrophils, monocytes, and T cells to infection sites
- P2X7 and EGFR activation – Triggers purinergic receptor P2X7 and epidermal growth factor receptor, mediating inflammatory cytokine release and wound repair signals
- Autophagy and apoptosis modulation – Can induce caspase-independent apoptosis pathways and suppress autophagy depending on cell type and concentration
Common Research Applications
Antimicrobial Resistance Studies: Multi-drug resistant bacterial strains, MRSA models, biofilm-associated infections, antibiotic-resistant E. coli, Pseudomonas aeruginosa resistance mechanisms
Biofilm Research: Staphylococcus aureus biofilms, prosthetic joint infections, catheter-associated infections, biofilm formation inhibition, quorum sensing disruption
Innate Immunity Models: Neutrophil degranulation, epithelial cell defense, endotoxin neutralization, immune cell recruitment, inflammatory response modulation
Wound Healing Research: Skin wound models, tissue repair mechanisms, angiogenesis studies, diabetic wound healing, burn injuries
Cancer Biology: Concentration-dependent effects in various cancers, tumor microenvironment studies, cancer cell migration and invasion, ovarian cancer models, colon cancer apoptosis, pancreatic cancer autophagy
Viral Research: SARS-CoV-2 spike protein interactions, antiviral mechanisms, Venezuelan equine encephalitis virus, broad-spectrum antiviral activity
Dermatological Research: Psoriasis models (LL-37 overexpression), atopic dermatitis (LL-37 deficiency), rosacea, skin infection susceptibility
Structure-Function Studies: Alpha-helix formation, oligomerization mechanisms, peptide fragment activity (KR-12, LL-37 17-29), structure-guided mutagenesis
What You’re Getting
Every batch of our LL-37 meets rigorous research standards:
- Exceeds 99% Purity – Verified by HPLC analysis
- Certificate of Analysis (COA) – Included with every order, showing purity and identity confirmation
- Endotoxin-Free – Tested to ensure <1 EU/mg for cell culture applications
- Manufactured in USA – GMP-certified facilities with full traceability
- Sterile & Lyophilized – Stable for long-term storage, easy reconstitution
- Fast Shipping – Most orders ship same day. We offer flat rate shipping and 2-3 day delivery in the USA
Click the “Add To Cart” button to grab your LL-37 today!
LL-37 Research & Scientific Overview
Jump to: Structure | Mechanism | Studies | Pharmacokinetics | Protocols | Limitations | Lead Researcher | References
LL-37 Molecular Structure & Chemical Properties
LL-37 peptide represents the only human cathelicidin antimicrobial peptide identified to date, distinguished by its exceptional multifunctionality beyond direct pathogen elimination. Originally discovered in the 1990s through investigations of neutrophil granule contents, this 37-amino acid peptide has demonstrated remarkable stability and diverse biological activities spanning antimicrobial defense, wound healing, and immunomodulation. Unlike most antimicrobial peptides that function solely through membrane disruption, LL-37 exhibits both direct bactericidal properties and complex immunoregulatory effects that position it uniquely within the innate immune system. The peptide derives from proteolytic cleavage of the larger precursor protein hCAP-18 (human cationic antimicrobial protein 18 kDa) by proteinase 3, generating the active C-terminal fragment that has sustained intensive research interest across multiple disciplines including infectious disease, dermatology, and wound care.
Chemical Structure
|
|
2D molecular structure (Source: PubChem)
Technical Specifications
| Property | Value |
|---|---|
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 (subscripted) |
| Molecular Weight | 4493.34 g/mol |
| Amino Acid Sequence | [LL-37, 37 aa] |
| Half-Life (Plasma) | Minutes to hours depending on proteolytic environment (varies by tissue context) |
| Stability | Relatively protease-resistant compared to other antimicrobial peptides; maintains activity in diverse biological environments |
| Solubility | Water soluble; soluble in saline and phosphate buffered solutions |
| Storage | Lyophilized: -20 degrees C; Reconstituted: 2-8 degrees C (stability varies by formulation and handling protocols) |
The peptide adopts an alpha-helical conformation in membrane environments, with a net positive charge of +6 at physiological pH that enables electrostatic interactions with negatively charged bacterial membranes. LL-37’s amphipathic structure – featuring distinct hydrophobic and hydrophilic faces – underlies its ability to insert into lipid bilayers and form various membrane-disrupting structures.
LL-37 Mechanism of Action
LL-37 peptide exerts its biological effects through multiple interconnected mechanisms that extend far beyond simple membrane disruption. Current research demonstrates that this peptide functions as a multifaceted immune mediator rather than a conventional single-target antimicrobial agent, with activities that span direct pathogen elimination, immune cell recruitment and activation, and tissue repair processes.
Primary Antimicrobial Mechanisms
Membrane Disruption – Direct Bactericidal Activity
Research has established that LL-37 employs diverse membrane-disrupting mechanisms depending on lipid composition and target cell type¹. The peptide’s primary antimicrobial action involves:
- Electrostatic binding to negatively charged bacterial membrane components including lipopolysaccharide (LPS) and lipoteichoic acid (LTA)
- Pore formation in membranes containing unsaturated lipids or cholesterol, causing rapid cell lysis
- Carpet mechanism on saturated lipid membranes, leading to membrane solubilization at threshold concentrations
- Intracellular targeting through membrane permeation to interact with nucleic acids and other cytoplasmic components²
Studies using electron microscopy and time-lapse imaging revealed that LL-37 perforates both outer and inner membranes of Gram-negative bacteria in a time-dependent manner, distinguishing its mechanism from other antimicrobial peptides³.
Immunomodulation – TLR Pathway Regulation
LL-37 demonstrates complex immunoregulatory properties through modulation of Toll-like receptor (TLR) signalingâ´:
- Inhibition of TLR2 and TLR4 activation by sequestering bacterial lipids (LTA and LPS), preventing excessive inflammatory responses
- Enhancement of TLR3, TLR7, TLR8, and TLR9 signaling by forming complexes with nucleic acids that protect them from degradation
- Dose-dependent effects on cytokine production, with low concentrations promoting homeostatic responses and higher concentrations inducing chemotaxis
- Context-dependent immune modulation where effects vary based on the activation state of target cells
Cell Migration and Chemotaxis
Investigations have shown LL-37 peptide functions as a potent chemoattractant for multiple immune cell typesâµ:
- Recruitment of neutrophils, monocytes, and T cells through formyl peptide receptor-like 1 (FPRL-1) activation
- Stimulation of keratinocyte migration via epidermal growth factor receptor (EGFR) transactivation
- Activation of focal adhesion kinase (FAK) and paxillin signaling pathways that regulate cell adhesion and movement
- Induction of actin cytoskeleton remodeling essential for cellular migration to injury sites
Wound Healing and Angiogenesis
Research has documented LL-37’s role in promoting tissue repair through multiple pathwaysâ¶:
- Angiogenesis stimulation through vascular endothelial growth factor (VEGF) pathway activation
- Proliferation enhancement of epithelial cells and fibroblasts at wound sites
- Matrix metalloproteinase activation facilitating tissue remodeling
- Re-epithelialization promotion in both acute and chronic wound models
Biofilm Disruption
Studies have revealed LL-37’s ability to interfere with bacterial biofilm formation and maturationâ·:
- Inhibition of biofilm formation by common wound pathogens including Staphylococcus aureus and Pseudomonas aeruginosa
- Disruption of established biofilms at concentrations below those required for direct bactericidal activity
- Modulation of bacterial twitching motility that affects biofilm architecture
- Potential synergistic effects with conventional antibiotics against biofilm-associated infections
LL-37 Research Applications & Key Findings
Antimicrobial and Anti-Biofilm Research
Bacterial Infection Studies
Extensive research in vitro and in animal models has examined LL-37’s antimicrobial spectrum and efficacyâ¸. Key findings include:
- Broad-spectrum activity against Gram-positive bacteria (Staphylococcus aureus, including MRSA), Gram-negative bacteria (Pseudomonas aeruginosa, Escherichia coli), and some fungal pathogens
- Synergistic effects with conventional antibiotics including beta-lactams and aminoglycosides in bacterial killing assays
- Enhanced lysozyme activity against Gram-positive pathogens through cooperative mechanisms
- Effective concentrations typically ranging from 1-10 micromolar in vitro, though tissue concentrations and activity in vivo remain incompletely characterized
Biofilm Research Applications
Investigations using polymicrobial biofilm models demonstrated LL-37’s potential against complex infectionsâ¹:
- Inhibition of biofilm formation by up to 68% when delivered via nanoparticle carriers compared to free peptide
- Downregulation of biofilm-associated genes including the ica operon responsible for polysaccharide intercellular adhesin synthesis
- Activity against preformed biofilms suggesting potential applications beyond prophylaxis
- Concentration-dependent effects with anti-biofilm activity at lower doses than required for direct bacterial killing
Wound Healing Research
Acute Wound Studies
Research in multiple animal models has evaluated LL-37’s wound healing properties¹â°:
- Accelerated wound closure in mouse excisional wound models, with topical application improving re-epithelialization rates
- Enhanced granulation tissue formation and collagen deposition at healing sites
- Increased vascularization through VEGF and hypoxia-inducible factor-1 alpha (HIF-1 alpha) upregulation
- Improved healing in immunocompromised models including diabetic mice
Chronic Wound Applications
Investigations into hard-to-heal wounds revealed variable efficacy patterns¹¹:
- Phase I/II human trials in venous leg ulcers showed dose-dependent effects, with 0.5 mg/mL and 1.6 mg/mL doses demonstrating improved healing parameters
- Larger phase IIb trial in 148 patients with venous leg ulcers did not show significant improvement in the full study population
- Post hoc analysis suggested potential benefit in subgroups with large wounds (greater than 10 square cm), a known negative prognostic factor
- Safety profile was favorable with no significant local or systemic adverse events reported
Infectious Disease Research
Respiratory Infection Studies
Research in pulmonary infection models demonstrated LL-37’s role in airway defense¹²:
- Expression in airway epithelium with levels modulated by vitamin D status and inflammatory conditions
- Protection against respiratory pathogens including Pseudomonas aeruginosa in pneumonia models
- Neutralization of bacterial endotoxins reducing LPS-induced inflammatory damage
- Wound healing promotion in damaged airway epithelium through EGFR-mediated pathways
Gastrointestinal Infection Research
Investigations in enteric disease models revealed protective effects in the digestive tract¹³:
- Downregulation during Shigella infections representing a potential immune escape mechanism
- Improved outcomes when endogenous LL-37 expression was induced by butyrate treatment in animal models
- Protection against pathogen colonization in intestinal epithelium
- Modulation of gut microbiota composition, though mechanisms remain under investigation
Urinary Tract Defense Studies
Research documented LL-37’s protective role against urinary infections¹â´:
- Constitutive expression in urinary tract epithelium providing continuous defense
- Protection against uropathogens including E. coli in bladder infection models
- Deficiency association with increased susceptibility to recurrent urinary tract infections
- Vitamin D-dependent regulation of expression levels in urinary epithelial cells
Cancer and Autoimmune Research
Cancer Cell Studies
Investigations have examined LL-37’s complex and sometimes contradictory roles in cancer biology¹âµ:
- Cytotoxic effects on colon cancer cells through caspase-independent apoptosis induction
- Tumor suppression in some models through bone morphogenetic protein signaling modulation
- Pro-tumorigenic effects in other contexts, particularly ovarian cancer, through FPRL-1 receptor activation
- Context-dependent outcomes suggesting tissue-specific and concentration-dependent mechanisms
Autoimmune Disease Research
Studies in autoimmune models revealed LL-37’s involvement in inflammatory disorders¹â¶:
- Elevated levels in psoriatic lesions, potentially contributing to inflammation through nucleic acid complex formation
- Association with lupus and rheumatoid arthritis, though causative versus correlative relationship remains unclear
- Protective effects in some arthritis models when administered exogenously
- Complex role in balancing pro-inflammatory and anti-inflammatory responses
LL-37 Pharmacokinetics & Metabolism
Absorption & Distribution
LL-37 exhibits pharmacokinetic properties that remain incompletely characterized, particularly in human systems¹â·. Available research from animal models and in vitro studies indicates:
- Topical application results in local tissue retention with variable systemic absorption depending on formulation and application site
- Mucosal delivery including oral and inhalation routes shows promise in preclinical models, though bioavailability data remain limited
- Tissue distribution patterns suggest preferential accumulation at sites of inflammation or infection
- Encapsulation strategies using nanoparticles or hydrogels significantly enhance stability and prolong local activity compared to free peptide
Studies using radiolabeled peptide in animal models demonstrated concentration at wound sites and in inflammatory tissues, suggesting some degree of targeted delivery¹â¸.
Metabolism & Elimination
The metabolic fate of LL-37 presents significant challenges for therapeutic development¹â¹:
- Rapid proteolytic degradation by various proteases in biological fluids limits peptide half-life to minutes in unprotected formulations
- Enzyme-specific cleavage by kallikreins, elastase, and other serine proteases generates fragments with altered activity profiles
- Clearance mechanisms likely involve both proteolytic breakdown and renal filtration, though detailed kinetic studies in humans are absent
- Modified analogs including D-amino acid variants and cyclized structures demonstrate enhanced protease resistance
The disconnect between short half-life and prolonged biological effects observed in some models suggests either sustained signaling cascade activation, formation of active metabolites, or tissue sequestration mechanisms that require further investigation.
Excretion Pathways
Limited data on LL-37 excretion indicates:
- Renal elimination of intact peptide and fragments likely contributes to clearance
- Metabolic breakdown products generated by proteolytic cleavage represent the primary elimination pathway
- Clearance rates vary substantially based on tissue environment and proteolytic activity
- Accumulation has not been reported in chronic dosing studies in animal models, though long-term human data are absent
LL-37 Research Protocols & Administration
Dosing in Published Research
Research investigations have employed diverse LL-37 concentrations across different experimental systems:
- In vitro antimicrobial assays: 1-10 micromolar typical effective concentration range; minimum inhibitory concentrations vary by pathogen
- Cell culture wound healing studies: 1-5 micrograms per mL for optimal proliferation and migration effects
- Mouse models: Topical application of 10-50 micrograms per wound or systemic delivery at various doses depending on model
- Human wound healing trials: 0.5, 1.6, and 3.2 mg/mL applied topically twice weekly, with lower doses showing better efficacy profiles
Important: These are experimental concentrations and dosing regimens used in research settings and cannot be extrapolated to other species or clinical applications due to significant differences in peptide metabolism, protease activity, immune system organization, tissue distribution, and pharmacokinetic parameters. Species-specific factors profoundly influence both efficacy and safety profiles, and optimal human dosing remains undefined.
Administration Routes in Research
Multiple delivery methods have been investigated in preclinical and clinical studies:
- Topical application – Most common route for wound healing research; used in human trials for chronic leg ulcers
- Subcutaneous injection – Employed in some animal infection models for systemic delivery
- Inhalation – Investigated for respiratory infection prevention and treatment in animal models
- Oral delivery – Examined for gastrointestinal applications, though bioavailability challenges limit efficacy
- Encapsulated formulations – Nanoparticle, hydrogel, and polymer-based carriers enhance stability and prolong activity
- Gene therapy approaches – Adenoviral delivery of LL-37 or precursor hCAP-18 explored in experimental wound models
Common Model Organisms
LL-37 and related cathelicidin peptides have been studied across multiple experimental systems:
- Cell culture – Human keratinocytes (HaCaT), colonic epithelial cells (HT-29), endothelial cells, macrophages, neutrophils
- Mice – C57BL/6, BALB/c, and diabetic (ob/ob) strains for wound healing, infection, and autoimmune models
- Rabbits – Shigella infection models, pressure ulcer studies, gastrointestinal research
- Rats – Limited studies compared to other species
- Human subjects – Small clinical trials for venous leg ulcers; various observational studies examining endogenous LL-37 levels in disease states
- Bacterial and fungal cultures – In vitro antimicrobial and biofilm assays across diverse pathogen species
Research Limitations & Regulatory Status
Critical Gaps in Current Evidence
Despite substantial preclinical investigation spanning over two decades, LL-37 faces significant translational barriers that limit its immediate therapeutic utility.
Lack of Human Clinical Data
The most substantial limitation is the paucity of completed human clinical trials:
- Only two published phase I/II trials examining topical application for venous leg ulcers, with mixed efficacy results
- No phase III trials completed or published in peer-reviewed literature
- Human pharmacokinetics remain largely uncharacterized beyond topical wound applications
- Optimal dosing regimens for human therapeutic use undefined across indications
- Long-term safety data in human subjects absent beyond short-term wound healing trials
Mechanistic Understanding Gaps
Fundamental aspects of LL-37’s mechanism remain incompletely understood:
- Receptor specificity across various cell types and biological activities not fully elucidated
- Structure-activity relationships for different biological functions require further investigation
- Dose-response relationships in vivo complicated by simultaneous antimicrobial, immunomodulatory, and wound healing effects
- Interaction with the microbiome and potential impacts on commensal bacterial populations inadequately studied
- Active metabolite identification and their contributions to biological effects unclear
Therapeutic Development Challenges
Several obstacles hinder therapeutic translation:
- Rapid proteolytic degradation in biological fluids necessitates protective formulations or chemical modifications
- Cost of production for peptides remains substantially higher than small molecule drugs
- Dose optimization complicated by multiple biological activities occurring across different concentration ranges
- Context-dependent effects including pro-tumorigenic activities in some cancer models raise safety concerns
- Autoimmune associations in psoriasis and other inflammatory conditions require careful evaluation
Long-Term Safety Considerations
Critical safety questions remain unanswered:
- Effects of chronic administration beyond several weeks unstudied even in animal models
- Impact on commensal microbiota and potential development of dysbiosis with prolonged use
- Immunogenicity potential with repeated dosing unclear, particularly for modified analogs
- Cancer risk assessment required given contradictory effects in different tumor models
- Resistance development by pathogens, though theoretically less likely than with conventional antibiotics, remains to be evaluated in long-term studies
Regulatory & Competitive Sport Status
FDA Position
LL-37 has not received FDA approval for any therapeutic indication:
- Not approved for human therapeutic use or medical applications
- Classification as an investigational new drug for ongoing clinical research
- Not approved for compounding in the United States
- Research use only designation for commercially available peptide
WADA Prohibition
World Anti-Doping Agency classification status:
- Not specifically listed as a prohibited substance in current WADA regulations as of 2025
- Antimicrobial peptides generally not regulated under anti-doping codes
- Potential future consideration depending on evidence of performance-enhancing effects
- Athletes should verify current status with appropriate regulatory authorities before use
Research Classification: LL-37 is available only for laboratory research use. It is not intended for human consumption, medical use, or veterinary applications. All research must be conducted under appropriate ethical oversight and regulatory compliance with institutional review board approval where applicable.
>Lead Researcher Spotlight
Professor Birgitta Agerberth, PhD
Professor of Medical Microbial Pathogenesis
Karolinska Institutet, Stockholm, Sweden
Professor Birgitta Agerberth has been a pioneering figure in cathelicidin research since the 1990s, leading investigations that have fundamentally shaped our understanding of LL-37’s role in human innate immunity. Her laboratory at Karolinska Institutet has published seminal work characterizing this peptide’s antimicrobial properties, immunomodulatory functions, and involvement in human health and disease. Appointed Professor of Medical Microbial Pathogenesis in 2008, Professor Agerberth’s research program has focused on understanding how the innate immune system maintains host-microbe homeostasis despite constant exposure to potential pathogens.
Professor Agerberth’s major research contributions include:
- Discovery and characterization of LL-37 as the sole human cathelicidin, establishing its antimicrobial spectrum and structural properties
- Elucidation of regulatory mechanisms controlling LL-37 expression, including vitamin D-dependent pathways and transcriptional regulation
- Investigation of immunomodulatory functions beyond direct antimicrobial activity, revealing LL-37’s role in inflammation regulation
- Clinical translation efforts examining LL-37 induction as a therapeutic strategy for infectious diseases
- Collaborative research spanning infectious diseases, dermatology, gastroenterology, and immunology
Her work has established LL-37 as one of the most comprehensively studied antimicrobial peptides in humans, though she has consistently emphasized the need for rigorous clinical validation before therapeutic applications can be realized.
Disclaimer: This spotlight is provided for educational purposes to acknowledge scientific contributions to LL-37 research. Cenexa Labs has no affiliation with Professor Agerberth or Karolinska Institutet, and this information does not constitute an endorsement of any products or services.
References
- Shahmiri, M., Enciso, M., Adda, C.G., Smith, B.J., Perugini, M.A., & Mechler, A. (2016). Membrane core-specific antimicrobial action of cathelicidin LL-37 peptide switches between pore and nanofibre formation. Scientific Reports, 6, 38184. PubMed
- Xhindoli, D., Pacor, S., Benincasa, M., Scocchi, M., Gennaro, R., & Tossi, A. (2016). The human antimicrobial peptide LL-37 – A pore-forming antibacterial agent and host-cell modulator. Biochimica et Biophysica Acta, 1858(3), 546-566. PubMed
- Morgera, F., Antcheva, N., Pacor, S., Quaroni, L., Berti, F., Vaccari, L., & Tossi, A. (2020). The structure of the antimicrobial human cathelicidin LL-37 shows oligomerization and channel formation in the presence of membrane mimics. Scientific Reports, 10, 17356. PubMed
- Scheenstra, M.R., van Harten, R.M., Veldhuizen, E.J.A., Haagsman, H.P., & Coorens, M. (2020). Cathelicidins modulate TLR-activation and inflammation. Frontiers in Immunology, 11, 1137. PubMed
- Yang, D., Chertov, O., Bykovskaia, S.N., Chen, Q., Buffo, M.J., Shogan, J., Anderson, M., Schroder, J.M., Wang, J.M., Howard, O.M., & Oppenheim, J.J. (2000). LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. Journal of Experimental Medicine, 192(7), 1069-1074. PubMed
- Carretero, M., Escámez, M.J., García, M., Duarte, B., Holguín, A., Retamosa, L., Jorcano, J.L., del Río, M., & Larcher, F. (2008). In vitro and in vivo wound healing-promoting activities of human cathelicidin LL-37. Journal of Investigative Dermatology, 128(1), 223-236. PubMed
- Dean, S.N., Bishop, B.M., & van Hoek, M.L. (2011). Natural and synthetic cathelicidin peptides with anti-microbial and anti-biofilm activity against Staphylococcus aureus. BMC Microbiology, 11, 114. PubMed
- Dürr, U.H., Sudheendra, U.S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta, 1758(9), 1408-1425. PubMed
- Khaleghian, A., Ahmadi, F., Jahromi, B.M., & Salami, M. (2022). Delivery LL37 by chitosan nanoparticles for enhanced antibacterial and antibiofilm efficacy. Carbohydrate Polymers, 291, 119626. PubMed
- Steinstraesser, L., Koehler, T., Jacobsen, F., Daigeler, A., Goertz, O., Langer, S., Kesting, M., Steinau, H., Eriksson, E., & Hirsch, T. (2008). Host defense peptides in wound healing. Molecular Medicine, 14(7-8), 528-537. PubMed
- Grönberg, A., Mahlapuu, M., Ståhle, M., Whately-Smith, C., & Rollman, O. (2014). Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair and Regeneration, 22(5), 613-621. PubMed
- Tjabringa, G.S., Ninaber, D.K., Drijfhout, J.W., Rabe, K.F., & Hiemstra, P.S. (2006). Human cathelicidin LL-37 is a chemoattractant for eosinophils and neutrophils that acts via formyl-peptide receptors. International Archives of Allergy and Immunology, 140(2), 103-112. PubMed
- Raqib, R., Sarker, P., Bergman, P., Ara, G., Lindh, M., Sack, D.A., Nasirul Islam, K.M., Gudmundsson, G.H., Andersson, J., & Agerberth, B. (2006). Improved outcome in shigellosis associated with butyrate induction of an endogenous peptide antibiotic. Proceedings of the National Academy of Sciences, 103(24), 9178-9183. PubMed
- Chromek, M., Slamová, Z., Bergman, P., Kovács, L., Podracká, L., Ehrén, I., Hökfelt, T., Gudmundsson, G.H., Gallo, R.L., Agerberth, B., & Brauner, A. (2006). The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nature Medicine, 12(6), 636-641. PubMed
- Coffelt, S.B., Tomchuck, S.L., Zwezdaryk, K.J., Danka, E.S., & Scandurro, A.B. (2009). Leucine leucine-37 uses formyl peptide receptor-like 1 to activate signal transduction pathways, stimulate oncogenic gene expression, and enhance the invasiveness of ovarian cancer cells. Molecular Cancer Research, 7(6), 907-915. PubMed
- Lande, R., Gregorio, J., Facchinetti, V., Chatterjee, B., Wang, Y.H., Homey, B., Cao, W., Wang, Y.H., Su, B., Nestle, F.O., Zal, T., Mellman, I., Schröder, J.M., Liu, Y.J., & Gilliet, M. (2007). Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature, 449(7162), 564-569. PubMed
- Bucki, R., Leszczynska, K., Namiot, A., & Sokolowski, W. (2010). Cathelicidin LL-37: a multitask antimicrobial peptide. Archivum Immunologiae et Therapiae Experimentalis, 58(1), 15-25. PubMed
- Li, X., Li, Y., Han, H., Miller, D.W., & Wang, G. (2006). Solution structures of human LL-37 fragments and NMR-based identification of a minimal membrane-targeting antimicrobial and anticancer region. Journal of the American Chemical Society, 128(17), 5776-5785. PubMed
- van der Does, A.M., Bergman, P., Agerberth, B., & Lindbom, L. (2012). Induction of the human cathelicidin LL-37 as a novel treatment against bacterial infections. Journal of Leukocyte Biology, 92(4), 735-742. PubMed
All references open in new window. These citations are provided for educational and research purposes only. This information is not intended to diagnose, treat, cure, or prevent any disease. LL-37 is intended for laboratory research use only.
The Cenexa Labs Gold Standard
Most peptide sites simply resell vials from overseas labs with little oversight or testing (Much of it is either fake or laced with contaminants). At Cenexa Labs, we manufacture our own peptides under strict USA-based standards…right here IN THE USA. From synthesis to lyophilization to final vial, every step is handled under our direct control — so you never have to question what you’re getting.
We might not be the cheapest, but you can count on our peptides being 100% legit and free from contaminants, heavy metals and toxins.
Why Researchers Choose Cenexa Labs
- End-to-End Chain of Custody: Every batch is logged, tested, and traceable — no middlemen, no relabeling, no guesswork.
- Lot-Linked COAs: Each vial’s lot number ties directly to third-party HPLC/MS results. No recycled or generic COAs.
- We’re the Manufacturer: Because we produce in-house, we control purity, potency, and compliance — instead of reselling from anonymous overseas labs.
- Verified Purity, Every Time: 99%+ purity confirmed on every batch by independent labs, not just claimed on a label.
- GMP-Aligned, USA Based: Manufactured domestically in controlled GMP, ISO 9001-audited facilities.
- Fast, Reliable Fulfillment: Orders placed by 2pm CST ship the same business day. Free USPS Priority on orders $300+. $9.95 Flat rate shipping on all other orders with 2-3 day delivery.
- Backed by Trust: Over 18,000 researchers nationwide rely on Cenexa Labs for consistent, verifiable peptides.
- Room Temperature (Unmixed): Lyophilized (powder) peptides are stable for 3–4 months at room temperature if kept sealed and away from direct light.
- Freezer (Unmixed): For long-term storage, place vials in a freezer. Depending on temperature, peptides can remain stable for 1–3 years.
- After Reconstitution: Once mixed with bacteriostatic water, peptides must be stored in the refrigerator and remain stable for up to 30 days.
All Cenexa peptides are manufactured 100% end-to-end here in the USA using the Lyophilization (Freeze Drying) process. This ensures maximum stability and quality.
Best Practice:
Only reconstitute your peptides when you’re ready to begin using them. Until then, keep vials in their lyophilized powder form, stored in the freezer and away from light.
Fast Processing: We strive to ship same-day. During high-volume times it may take 2–3 days for your package to enter the mailstream. (You’ll see a notice at checkout and can upgrade if you need guaranteed same-day shipping.)
- Flat Rate Shipping: $9.95 on all orders (USPS Priority Mail 2–3 days).
- Free Shipping: Orders over $300 ship free.
- Expedited Options: Faster methods available at checkout.
Important: Orders paid by eCheck won’t ship until payment clears our bank (usually 2–3 business days after it leaves your account).
All products are carefully packaged for safe arrival.
Need help with your order or delivery?
- Call us at +1 800 123 4567
- [email protected]
See What Some Of Our 18,000+ Happy Customers Have To Say…
Related products
-
Peptides
Kisspeptin-10
$59.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
Ipamorelin
$43.99 – $64.99Price range: $43.99 through $64.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
IGF-1 DES
$74.99 Select options This product has multiple variants. The options may be chosen on the product page -
Peptides
CJC-1295 (NO DAC) + Ipamorelin
$79.99 Select options This product has multiple variants. The options may be chosen on the product page






